BLASTX nr result
ID: Panax25_contig00048653
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00048653 (438 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017248477.1 PREDICTED: F-box/LRR-repeat protein 3-like [Daucu... 60 1e-07 >XP_017248477.1 PREDICTED: F-box/LRR-repeat protein 3-like [Daucus carota subsp. sativus] KZM97283.1 hypothetical protein DCAR_015355 [Daucus carota subsp. sativus] Length = 667 Score = 59.7 bits (143), Expect = 1e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -3 Query: 118 AMKKQKHKTASNINLFDHLSEEIIFTILDSLTDNPFDTK 2 AMKKQK +SN NLFDHLSEE+IF ILD L D+PFD+K Sbjct: 2 AMKKQKTTPSSNFNLFDHLSEELIFLILDHLKDSPFDSK 40