BLASTX nr result
ID: Panax25_contig00048342
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00048342 (539 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW11784.1 hypothetical protein TanjilG_14324 [Lupinus angustifo... 51 9e-06 >OIW11784.1 hypothetical protein TanjilG_14324 [Lupinus angustifolius] Length = 63 Score = 51.2 bits (121), Expect = 9e-06 Identities = 24/44 (54%), Positives = 33/44 (75%) Frame = -3 Query: 498 RVTGNSDGCHLKAIPMENPKSKSNSYGAPLIVSHFPIRSYLSPL 367 +V+ +++G LK+I E PKSKS S GAP++VS+FPI SY S L Sbjct: 20 QVSDHAEGSQLKSISSEKPKSKSESKGAPIVVSYFPINSYPSRL 63