BLASTX nr result
ID: Panax25_contig00048260
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00048260 (578 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010523177.1 PREDICTED: uncharacterized protein LOC104801567 [... 72 1e-14 JAU51200.1 LINE-1 retrotransposable element ORF2 protein, partia... 67 1e-14 XP_018453891.1 PREDICTED: uncharacterized protein LOC108825045 [... 72 2e-14 XP_013589311.1 PREDICTED: uncharacterized protein LOC106297655 [... 68 3e-14 JAU30367.1 putative mitochondrial protein, partial [Noccaea caer... 70 5e-14 XP_010446092.1 PREDICTED: uncharacterized protein LOC104728863 [... 67 5e-14 XP_018473851.1 PREDICTED: uncharacterized protein LOC108845081 [... 68 9e-14 XP_013694032.1 PREDICTED: uncharacterized protein LOC106397955 [... 67 9e-14 XP_010530470.1 PREDICTED: uncharacterized protein LOC104807056 [... 69 1e-13 XP_010521059.1 PREDICTED: uncharacterized protein LOC104800051 [... 69 1e-13 ABD96948.1 hypothetical protein [Tarenaya spinosa] 68 2e-13 XP_010495447.1 PREDICTED: uncharacterized protein LOC104772543 [... 64 3e-13 KFK28833.1 hypothetical protein AALP_AA7G055000 [Arabis alpina] 68 4e-13 XP_013738980.1 PREDICTED: uncharacterized protein LOC106441757 [... 69 4e-13 KFK28834.1 hypothetical protein AALP_AA7G055000 [Arabis alpina] 68 4e-13 JAU87460.1 hypothetical protein MP_TR6174_c2_g1_i1_g.17484, part... 66 5e-13 XP_013595094.1 PREDICTED: uncharacterized protein LOC106303347 [... 63 1e-12 XP_011083323.1 PREDICTED: uncharacterized protein LOC105165859 [... 65 2e-12 GAV91855.1 RVT_1 domain-containing protein/Exo_endo_phos domain-... 68 2e-12 XP_013738766.1 PREDICTED: uncharacterized protein LOC106441504 [... 61 3e-12 >XP_010523177.1 PREDICTED: uncharacterized protein LOC104801567 [Tarenaya hassleriana] Length = 1199 Score = 72.0 bits (175), Expect(2) = 1e-14 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +3 Query: 450 FINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 F+NWI+AC++T FS+ +NG L GYF G RGLRQG+PLSPYLF Sbjct: 771 FVNWIKACVTTPKFSIAINGELVGYFKGRRGLRQGDPLSPYLF 813 Score = 35.0 bits (79), Expect(2) = 1e-14 Identities = 14/28 (50%), Positives = 20/28 (71%) Frame = +1 Query: 361 QKKGPARRDFKIDLRKAFDNVSWDFLFK 444 +K PA KID++KAFD +SW+FL + Sbjct: 733 RKNTPASAMVKIDIKKAFDTLSWEFLMR 760 >JAU51200.1 LINE-1 retrotransposable element ORF2 protein, partial [Noccaea caerulescens] JAU76745.1 LINE-1 retrotransposable element ORF2 protein, partial [Noccaea caerulescens] Length = 142 Score = 66.6 bits (161), Expect(2) = 1e-14 Identities = 29/53 (54%), Positives = 37/53 (69%) Frame = +3 Query: 420 CVLGFSL*DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 C+ G L +I W++ACI T F++ NG + GYF G RGLRQG+PLSPYLF Sbjct: 61 CLEGLLLPQEYIGWLKACICTTNFTIGYNGVVHGYFKGKRGLRQGDPLSPYLF 113 Score = 40.4 bits (93), Expect(2) = 1e-14 Identities = 16/27 (59%), Positives = 21/27 (77%) Frame = +1 Query: 361 QKKGPARRDFKIDLRKAFDNVSWDFLF 441 + KGP R K+D+ KAFD+VSW+FLF Sbjct: 33 KNKGPKRITIKVDIAKAFDSVSWEFLF 59 >XP_018453891.1 PREDICTED: uncharacterized protein LOC108825045 [Raphanus sativus] Length = 769 Score = 71.6 bits (174), Expect(2) = 2e-14 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +3 Query: 420 CVLGFSL*DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 C+ G +L +I WIRAC+ T F+V NG + GYFNG RGLRQG+PLSPYLF Sbjct: 165 CLEGLNLPREYIAWIRACVCTTTFTVGYNGMVNGYFNGSRGLRQGDPLSPYLF 217 Score = 34.7 bits (78), Expect(2) = 2e-14 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = +1 Query: 370 GPARRDFKIDLRKAFDNVSWDFLF 441 G R K+D+ KAFD +SWDFLF Sbjct: 140 GAKRITLKVDVAKAFDTLSWDFLF 163 >XP_013589311.1 PREDICTED: uncharacterized protein LOC106297655 [Brassica oleracea var. oleracea] Length = 1066 Score = 68.2 bits (165), Expect(2) = 3e-14 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 420 CVLGFSL*DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 C+ G L D F W+RAC+ T+ F++ NG + GYF G RGLRQG+P+SPYLF Sbjct: 461 CLEGLQLPDLFRQWLRACVCTSSFTLGYNGTVNGYFKGRRGLRQGDPMSPYLF 513 Score = 37.4 bits (85), Expect(2) = 3e-14 Identities = 15/27 (55%), Positives = 19/27 (70%) Frame = +1 Query: 361 QKKGPARRDFKIDLRKAFDNVSWDFLF 441 + KG R K+D+ KAFD +SWDFLF Sbjct: 433 KNKGEKRITIKVDIAKAFDTLSWDFLF 459 >JAU30367.1 putative mitochondrial protein, partial [Noccaea caerulescens] Length = 113 Score = 70.5 bits (171), Expect(2) = 5e-14 Identities = 29/53 (54%), Positives = 40/53 (75%) Frame = +3 Query: 420 CVLGFSL*DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 C+ G S+ D F++W+++CI T F++ NG + GYF G RGLRQG+PLSPYLF Sbjct: 20 CLEGLSIPDQFLHWLKSCICTTNFTIGYNGMVQGYFKGKRGLRQGDPLSPYLF 72 Score = 34.7 bits (78), Expect(2) = 5e-14 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = +1 Query: 391 KIDLRKAFDNVSWDFLF 441 K+D+ KAFD+VSWDFLF Sbjct: 2 KVDIAKAFDSVSWDFLF 18 >XP_010446092.1 PREDICTED: uncharacterized protein LOC104728863 [Camelina sativa] Length = 772 Score = 67.4 bits (163), Expect(2) = 5e-14 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = +3 Query: 420 CVLGFSL*DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 C+ G + +++ W++ACI T FSV NG++ GYF G RGLRQG+PLSPYLF Sbjct: 696 CLRGIEVPETYQRWLKACICTPSFSVGFNGHVHGYFKGLRGLRQGDPLSPYLF 748 Score = 37.4 bits (85), Expect(2) = 5e-14 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +1 Query: 364 KKGPARRDFKIDLRKAFDNVSWDFLF 441 +KGP R K+D+ KAFD V W+F+F Sbjct: 669 EKGPKRITIKVDIAKAFDTVRWEFIF 694 >XP_018473851.1 PREDICTED: uncharacterized protein LOC108845081 [Raphanus sativus] Length = 1089 Score = 67.8 bits (164), Expect(2) = 9e-14 Identities = 29/53 (54%), Positives = 38/53 (71%) Frame = +3 Query: 420 CVLGFSL*DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 C+ G L D I+W++AC+ T F++ NG + GYF G RGLRQG+PLSPYLF Sbjct: 481 CLQGLHLPDILISWLKACVCTPHFTIGYNGMVQGYFKGKRGLRQGDPLSPYLF 533 Score = 36.2 bits (82), Expect(2) = 9e-14 Identities = 14/27 (51%), Positives = 19/27 (70%) Frame = +1 Query: 361 QKKGPARRDFKIDLRKAFDNVSWDFLF 441 + K P R K+D+ KAFD +SW+FLF Sbjct: 453 KNKDPKRITIKVDIAKAFDTLSWEFLF 479 >XP_013694032.1 PREDICTED: uncharacterized protein LOC106397955 [Brassica napus] Length = 1081 Score = 67.0 bits (162), Expect(2) = 9e-14 Identities = 29/53 (54%), Positives = 36/53 (67%) Frame = +3 Query: 420 CVLGFSL*DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 C+ G L + I WI+ CIST F + NG + GYF +RGLRQG+PLSPYLF Sbjct: 489 CLQGMGLPQTLIQWIQVCISTPSFMIGFNGTVQGYFKSNRGLRQGDPLSPYLF 541 Score = 37.0 bits (84), Expect(2) = 9e-14 Identities = 14/25 (56%), Positives = 19/25 (76%) Frame = +1 Query: 367 KGPARRDFKIDLRKAFDNVSWDFLF 441 KGP+R K+D+ KAFD V+W F+F Sbjct: 463 KGPSRITLKVDIAKAFDTVNWRFIF 487 >XP_010530470.1 PREDICTED: uncharacterized protein LOC104807056 [Tarenaya hassleriana] Length = 809 Score = 68.6 bits (166), Expect(2) = 1e-13 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +3 Query: 444 DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 D F+ WI CI+T FS+ +NG L GYF G RGLRQG+PLSPYLF Sbjct: 693 DRFVGWIEQCITTTKFSIAINGELHGYFPGTRGLRQGDPLSPYLF 737 Score = 35.0 bits (79), Expect(2) = 1e-13 Identities = 14/25 (56%), Positives = 17/25 (68%) Frame = +1 Query: 364 KKGPARRDFKIDLRKAFDNVSWDFL 438 K P K+D+RKAFD V+WDFL Sbjct: 658 KSSPRSAMLKLDIRKAFDTVNWDFL 682 >XP_010521059.1 PREDICTED: uncharacterized protein LOC104800051 [Tarenaya hassleriana] Length = 1214 Score = 69.3 bits (168), Expect(2) = 1e-13 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = +3 Query: 444 DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 D F++WI+ CI+T FS+ +NG L GYF G RGLRQG+PLSPYLF Sbjct: 748 DRFVDWIQQCITTTKFSIAINGELHGYFPGTRGLRQGDPLSPYLF 792 Score = 33.9 bits (76), Expect(2) = 1e-13 Identities = 13/25 (52%), Positives = 17/25 (68%) Frame = +1 Query: 364 KKGPARRDFKIDLRKAFDNVSWDFL 438 K P K+D+RKAFD ++WDFL Sbjct: 713 KSSPRSAMLKLDIRKAFDTMNWDFL 737 >ABD96948.1 hypothetical protein [Tarenaya spinosa] Length = 539 Score = 68.2 bits (165), Expect(2) = 2e-13 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +3 Query: 447 SFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 +F+ W++ C+ T FSV +NG L GYF G RGLRQG+PLSPYLF Sbjct: 71 TFVTWVKVCMETPKFSVSINGELAGYFKGRRGLRQGDPLSPYLF 114 Score = 34.7 bits (78), Expect(2) = 2e-13 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = +1 Query: 379 RRDFKIDLRKAFDNVSWDFLFK 444 R KIDLRKAFD VSW+F+ K Sbjct: 40 RAMLKIDLRKAFDTVSWEFITK 61 >XP_010495447.1 PREDICTED: uncharacterized protein LOC104772543 [Camelina sativa] Length = 1066 Score = 64.3 bits (155), Expect(2) = 3e-13 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = +3 Query: 420 CVLGFSL*DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 C+ + + ++ W++ACI T F++ NG + GYF G RGLRQG+PLSPYLF Sbjct: 437 CLKALEIPNQYLRWLQACICTPNFTIGYNGTVQGYFKGRRGLRQGDPLSPYLF 489 Score = 38.1 bits (87), Expect(2) = 3e-13 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +1 Query: 361 QKKGPARRDFKIDLRKAFDNVSWDFLF 441 + +GP R K+D+ KAFD +SWDFLF Sbjct: 409 KSQGPKRIVIKVDIAKAFDTLSWDFLF 435 >KFK28833.1 hypothetical protein AALP_AA7G055000 [Arabis alpina] Length = 1415 Score = 67.8 bits (164), Expect(2) = 4e-13 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +3 Query: 459 WIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 WI CI+T FS+ +NG LCGYF G RGLRQG+P+SPYLF Sbjct: 823 WIEQCITTTSFSINVNGELCGYFKGKRGLRQGDPISPYLF 862 Score = 33.9 bits (76), Expect(2) = 4e-13 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = +1 Query: 361 QKKGPARRDFKIDLRKAFDNVSWDFL 438 +K AR K+DLRKAFD+V+W+F+ Sbjct: 782 KKSVSARGLLKVDLRKAFDSVNWEFI 807 >XP_013738980.1 PREDICTED: uncharacterized protein LOC106441757 [Brassica napus] Length = 1118 Score = 68.6 bits (166), Expect(2) = 4e-13 Identities = 28/53 (52%), Positives = 38/53 (71%) Frame = +3 Query: 420 CVLGFSL*DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 C+ +++ ++ I W+ AC+ T FSV NG+ GYF G RGLRQG+PLSPYLF Sbjct: 513 CLRSYNIPEALIRWLEACVCTPSFSVAFNGSTYGYFKGKRGLRQGDPLSPYLF 565 Score = 33.1 bits (74), Expect(2) = 4e-13 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +1 Query: 361 QKKGPARRDFKIDLRKAFDNVSWDFLF 441 ++ G R K+D+ KAFD V W+FLF Sbjct: 485 RRGGQKRITIKVDIAKAFDTVRWEFLF 511 >KFK28834.1 hypothetical protein AALP_AA7G055000 [Arabis alpina] Length = 1002 Score = 67.8 bits (164), Expect(2) = 4e-13 Identities = 27/40 (67%), Positives = 32/40 (80%) Frame = +3 Query: 459 WIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 WI CI+T FS+ +NG LCGYF G RGLRQG+P+SPYLF Sbjct: 823 WIEQCITTTSFSINVNGELCGYFKGKRGLRQGDPISPYLF 862 Score = 33.9 bits (76), Expect(2) = 4e-13 Identities = 14/26 (53%), Positives = 20/26 (76%) Frame = +1 Query: 361 QKKGPARRDFKIDLRKAFDNVSWDFL 438 +K AR K+DLRKAFD+V+W+F+ Sbjct: 782 KKSVSARGLLKVDLRKAFDSVNWEFI 807 >JAU87460.1 hypothetical protein MP_TR6174_c2_g1_i1_g.17484, partial [Noccaea caerulescens] Length = 118 Score = 66.2 bits (160), Expect(2) = 5e-13 Identities = 30/53 (56%), Positives = 37/53 (69%) Frame = +3 Query: 420 CVLGFSL*DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 C+ G S + I+W++ACI T F+V NG GYF G RGLRQG+PLSPYLF Sbjct: 62 CLEGLSFPNQHISWLKACICTTHFTVGYNGTGQGYFKGKRGLRQGDPLSPYLF 114 Score = 35.4 bits (80), Expect(2) = 5e-13 Identities = 13/27 (48%), Positives = 19/27 (70%) Frame = +1 Query: 361 QKKGPARRDFKIDLRKAFDNVSWDFLF 441 + KG + K+D+ KAFD +SW+FLF Sbjct: 34 KNKGAKKITLKVDIAKAFDTISWEFLF 60 >XP_013595094.1 PREDICTED: uncharacterized protein LOC106303347 [Brassica oleracea var. oleracea] Length = 1077 Score = 62.8 bits (151), Expect(2) = 1e-12 Identities = 26/53 (49%), Positives = 34/53 (64%) Frame = +3 Query: 420 CVLGFSL*DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 C+ G + + W+R C+ T F + NG + GYF G RGLRQG+PLSPYLF Sbjct: 471 CLQGLGVPEILTGWLRKCVCTTNFMIGYNGRVQGYFKGKRGLRQGDPLSPYLF 523 Score = 37.4 bits (85), Expect(2) = 1e-12 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +1 Query: 361 QKKGPARRDFKIDLRKAFDNVSWDFLF 441 ++ GP R K+D+ KAFD +SW+FLF Sbjct: 443 KRHGPKRITIKVDIAKAFDTLSWEFLF 469 >XP_011083323.1 PREDICTED: uncharacterized protein LOC105165859 [Sesamum indicum] Length = 736 Score = 65.5 bits (158), Expect(2) = 2e-12 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +3 Query: 432 FSL*DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 F +F WI CIST FSV LNGN G+F+G RGLRQG+PLSP+LF Sbjct: 453 FGFPPTFTRWIEECISTTSFSVGLNGNPHGFFDGTRGLRQGDPLSPFLF 501 Score = 34.3 bits (77), Expect(2) = 2e-12 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +2 Query: 308 RRIGDNSLIAQELFRGYNKKR 370 R IGDN L+AQELF GYN+ R Sbjct: 403 RSIGDNILLAQELFTGYNQTR 423 >GAV91855.1 RVT_1 domain-containing protein/Exo_endo_phos domain-containing protein, partial [Cephalotus follicularis] Length = 651 Score = 67.8 bits (164), Expect(2) = 2e-12 Identities = 28/44 (63%), Positives = 37/44 (84%) Frame = +3 Query: 447 SFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 +F++WI CIST M+S+ +NG++ GYF G RGLRQG+PLSPYLF Sbjct: 536 NFVHWIHQCISTPMYSLVINGSMNGYFPGKRGLRQGDPLSPYLF 579 Score = 32.0 bits (71), Expect(2) = 2e-12 Identities = 11/24 (45%), Positives = 17/24 (70%) Frame = +1 Query: 367 KGPARRDFKIDLRKAFDNVSWDFL 438 +G AR K+D+ KAFD + W+F+ Sbjct: 501 RGVARCAIKVDIHKAFDTIEWEFI 524 >XP_013738766.1 PREDICTED: uncharacterized protein LOC106441504 [Brassica napus] Length = 979 Score = 60.8 bits (146), Expect(2) = 3e-12 Identities = 25/53 (47%), Positives = 35/53 (66%) Frame = +3 Query: 420 CVLGFSL*DSFINWIRACISTAMFSVKLNGNLCGYFNGDRGLRQGNPLSPYLF 578 C+ G + I W++AC+ + F+ NG + GYF G+RGLRQG+PLS YLF Sbjct: 370 CLQGIQIPSQLIEWLKACVCSTNFTAGYNGMVHGYFKGNRGLRQGDPLSSYLF 422 Score = 38.1 bits (87), Expect(2) = 3e-12 Identities = 14/26 (53%), Positives = 21/26 (80%) Frame = +1 Query: 361 QKKGPARRDFKIDLRKAFDNVSWDFL 438 +++GP R FK+D+ KAFD +SW+FL Sbjct: 342 RRQGPKRITFKVDIVKAFDTISWEFL 367