BLASTX nr result
ID: Panax25_contig00047822
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00047822 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_173477.1 hypothetical protein NitaMp140 [Nicotiana tabacum] B... 141 3e-41 KJB09734.1 hypothetical protein B456_001G161000, partial [Gossyp... 144 8e-41 NP_064104.1 orf110b gene product (mitochondrion) [Beta vulgaris ... 94 2e-22 YP_007516853.1 hypothetical protein GlmaxMp03 (mitochondrion) [G... 65 6e-11 EYU25691.1 hypothetical protein MIMGU_mgv1a018587mg, partial [Er... 62 2e-10 GAU48497.1 hypothetical protein TSUD_291830 [Trifolium subterran... 39 4e-09 >YP_173477.1 hypothetical protein NitaMp140 [Nicotiana tabacum] BAD83543.1 hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 116 Score = 141 bits (356), Expect = 3e-41 Identities = 80/116 (68%), Positives = 83/116 (71%), Gaps = 7/116 (6%) Frame = +3 Query: 21 MNTQTELAHPFGHRDARTNPSNPPLF-ESASSKIGR--RQKAV*----RRSAXXXXXXXX 179 MNTQTELAHPFGHRDARTNPSN PLF ESASSK + RQKAV R Sbjct: 1 MNTQTELAHPFGHRDARTNPSNQPLFFESASSKPPQPYRQKAVRIVQERSHFIAYSFTFI 60 Query: 180 XXXXRLAPGLWTLRPLRSGFEPLTQGFSVLCSNQLSYLNHLPKVCFLYRIAPYLTT 347 L +WT R LRSGFEPLTQGFSVLCSNQLSYLNH PKVCFL+RIAPYLTT Sbjct: 61 SKSGSLPATVWTFRLLRSGFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPYLTT 116 >KJB09734.1 hypothetical protein B456_001G161000, partial [Gossypium raimondii] Length = 244 Score = 144 bits (364), Expect = 8e-41 Identities = 81/124 (65%), Positives = 84/124 (67%) Frame = +3 Query: 3 YRSTRSMNTQTELAHPFGHRDARTNPSNPPLFESASSKIGRRQKAV*RRSAXXXXXXXXX 182 YRS RSMNT+TELAHPFGHR ARTNPSN PLF + Sbjct: 34 YRSARSMNTRTELAHPFGHRGARTNPSNQPLFYFLICLPHYTAFCL-----LLSLEFKNP 88 Query: 183 XXXRLAPGLWTLRPLRSGFEPLTQGFSVLCSNQLSYLNHLPKVCFLYRIAPYLTT*LVRE 362 RL LWTLRPLRSGFEPLTQGFSVLCSNQLSYLNH PKV FL+RIAPYLTT LVRE Sbjct: 89 ARSRLRV-LWTLRPLRSGFEPLTQGFSVLCSNQLSYLNHFPKVSFLHRIAPYLTTLLVRE 147 Query: 363 KPFT 374 KP T Sbjct: 148 KPLT 151 >NP_064104.1 orf110b gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] YP_004222346.1 hypothetical protein BevumaM_p112 (mitochondrion) [Beta vulgaris subsp. maritima] YP_004842151.1 hypothetical protein BemaM_p107 (mitochondrion) [Beta macrocarpa] BAA99498.1 orf110b (mitochondrion) [Beta vulgaris subsp. vulgaris] CBJ14076.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ17566.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBJ20714.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] CBX24956.1 hypothetical protein (mitochondrion) [Beta macrocarpa] CBL51962.1 hypothetical protein (mitochondrion) [Beta vulgaris subsp. maritima] Length = 110 Score = 94.0 bits (232), Expect = 2e-22 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +3 Query: 195 LAPGLWTLRPLRSGFEPLTQGFSVLCSNQLSYLNHLPKVCFLYRIAPY 338 LA WTLRPLRSGFEPLTQGFSVLCSNQLSYLNH PKVCFL+RIAPY Sbjct: 36 LAHPFWTLRPLRSGFEPLTQGFSVLCSNQLSYLNHFPKVCFLHRIAPY 83 >YP_007516853.1 hypothetical protein GlmaxMp03 (mitochondrion) [Glycine max] AFR34334.1 hypothetical protein GlmaxMp03 (mitochondrion) [Glycine max] Length = 150 Score = 65.5 bits (158), Expect = 6e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +3 Query: 3 YRSTRSMNTQTELAHPFGHRDARTNPSNPPLF 98 YRSTRSM T+TELAHPFGHRDARTNPSN PLF Sbjct: 91 YRSTRSMKTRTELAHPFGHRDARTNPSNQPLF 122 >EYU25691.1 hypothetical protein MIMGU_mgv1a018587mg, partial [Erythranthe guttata] Length = 90 Score = 62.4 bits (150), Expect = 2e-10 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 3 YRSTRSMNTQTELAHPFGHRDARTNPSNPPLFES 104 YR TRSM TQTELAHPFGHRDARTNP+N P F S Sbjct: 18 YRFTRSMKTQTELAHPFGHRDARTNPNNQPFFLS 51 >GAU48497.1 hypothetical protein TSUD_291830 [Trifolium subterraneum] Length = 481 Score = 39.3 bits (90), Expect(3) = 4e-09 Identities = 24/44 (54%), Positives = 25/44 (56%), Gaps = 4/44 (9%) Frame = -3 Query: 162 KCERSCAIRLFGVALSCWRQIQKAVDYSD----WFSRPCAQKDG 43 KCERSC IRLFGVALS D+ FSRP AQK G Sbjct: 36 KCERSCTIRLFGVALSLSCLAGVEADFLKKRLIRFSRPYAQKKG 79 Score = 35.4 bits (80), Expect(3) = 4e-09 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = -2 Query: 52 KGWASSV*VFIDRVDLY 2 KGWASSV VFIDRVDLY Sbjct: 78 KGWASSVRVFIDRVDLY 94 Score = 32.7 bits (73), Expect(3) = 4e-09 Identities = 15/16 (93%), Positives = 16/16 (100%) Frame = -1 Query: 323 IKKTYFRKVVQVAQLV 276 +KKTYFRKVVQVAQLV Sbjct: 1 MKKTYFRKVVQVAQLV 16