BLASTX nr result
ID: Panax25_contig00047529
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00047529 (748 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM87636.1 hypothetical protein DCAR_031924 [Daucus carota subsp... 58 4e-06 KZM94204.1 hypothetical protein DCAR_017447 [Daucus carota subsp... 57 6e-06 >KZM87636.1 hypothetical protein DCAR_031924 [Daucus carota subsp. sativus] Length = 338 Score = 57.8 bits (138), Expect = 4e-06 Identities = 23/56 (41%), Positives = 36/56 (64%) Frame = -1 Query: 745 LPHPSLICGLCRQAGVRWFGDETTQMSLQTLDTRMIARYSVWPGGESHPRGVGYIF 578 +P+ +++ LCR +GVRW +E Q+ +D I+R + W GG HPRG+GYI+ Sbjct: 181 IPYGTIVTKLCRSSGVRWPANEQLQLPAAPIDHSAISRMTEWDGGVPHPRGLGYIY 236 >KZM94204.1 hypothetical protein DCAR_017447 [Daucus carota subsp. sativus] Length = 402 Score = 57.4 bits (137), Expect = 6e-06 Identities = 23/56 (41%), Positives = 36/56 (64%) Frame = -1 Query: 745 LPHPSLICGLCRQAGVRWFGDETTQMSLQTLDTRMIARYSVWPGGESHPRGVGYIF 578 +P+ +++ LCR +GVRW +E Q+ +D I+R + W GG HPRG+GYI+ Sbjct: 245 IPYGTIVTKLCRASGVRWPANEQLQLPAAPIDHSAISRMTEWDGGVPHPRGLGYIY 300