BLASTX nr result
ID: Panax25_contig00047013
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00047013 (530 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AIU48356.1 pseudouridine synthase family protein, partial [Artem... 63 6e-09 AIU48364.1 pseudouridine synthase family protein, partial [Lactu... 63 1e-08 XP_017215646.1 PREDICTED: RNA pseudouridine synthase 7 isoform X... 63 1e-08 AIU48335.1 pseudouridine synthase family protein, partial [Citru... 63 1e-08 XP_017215645.1 PREDICTED: RNA pseudouridine synthase 7 isoform X... 63 1e-08 KZV28746.1 RNA pseudouridine synthase 7-like [Dorcoceras hygrome... 63 1e-08 AIU48324.1 pseudouridine synthase family protein, partial [Magno... 63 2e-08 AIU48367.1 pseudouridine synthase family protein, partial [Plata... 63 2e-08 AIU48331.1 pseudouridine synthase family protein, partial [Citru... 63 2e-08 XP_006436899.1 hypothetical protein CICLE_v10031733mg [Citrus cl... 63 2e-08 KDO64481.1 hypothetical protein CISIN_1g015203mg [Citrus sinensis] 63 2e-08 XP_006436898.1 hypothetical protein CICLE_v10031733mg [Citrus cl... 63 2e-08 KDO64480.1 hypothetical protein CISIN_1g015203mg [Citrus sinensis] 63 2e-08 XP_011083553.1 PREDICTED: RNA pseudouridine synthase 7 [Sesamum ... 62 3e-08 AIU48357.1 pseudouridine synthase family protein, partial [Ricin... 62 4e-08 XP_002511129.1 PREDICTED: RNA pseudouridine synthase 7 [Ricinus ... 62 5e-08 XP_016469598.1 PREDICTED: RNA pseudouridine synthase 7-like [Nic... 62 5e-08 XP_009600104.1 PREDICTED: RNA pseudouridine synthase 7 [Nicotian... 62 5e-08 XP_010093931.1 RNA pseudourine synthase 7 [Morus notabilis] EXB5... 62 5e-08 AIU48350.1 pseudouridine synthase family protein, partial [Eryth... 61 6e-08 >AIU48356.1 pseudouridine synthase family protein, partial [Artemisia annua] Length = 225 Score = 63.2 bits (152), Expect = 6e-09 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAPLFPI Sbjct: 119 VHPCGQYRKNTVVGILQAEHDLAPLFPI 146 >AIU48364.1 pseudouridine synthase family protein, partial [Lactuca sativa] Length = 310 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAPLFPI Sbjct: 119 VHPCGQYRKNTVVGILQAEHDLAPLFPI 146 >XP_017215646.1 PREDICTED: RNA pseudouridine synthase 7 isoform X2 [Daucus carota subsp. sativus] Length = 329 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAPLFPI Sbjct: 134 VHPCGQYRKNTVVGILQAEHDLAPLFPI 161 >AIU48335.1 pseudouridine synthase family protein, partial [Citrus sinensis] Length = 282 Score = 62.8 bits (151), Expect = 1e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAPLFP+ Sbjct: 119 VHPCGQYRKNTVVGILQAEHDLAPLFPV 146 >XP_017215645.1 PREDICTED: RNA pseudouridine synthase 7 isoform X1 [Daucus carota subsp. sativus] KZM89161.1 hypothetical protein DCAR_026236 [Daucus carota subsp. sativus] Length = 382 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAPLFPI Sbjct: 134 VHPCGQYRKNTVVGILQAEHDLAPLFPI 161 >KZV28746.1 RNA pseudouridine synthase 7-like [Dorcoceras hygrometricum] Length = 396 Score = 63.2 bits (152), Expect = 1e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAPLFPI Sbjct: 146 VHPCGQYRKNTVVGILQAEHDLAPLFPI 173 >AIU48324.1 pseudouridine synthase family protein, partial [Magnolia denudata] Length = 309 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAPLFP+ Sbjct: 119 VHPCGQYRKNTVVGILQAEHDLAPLFPV 146 >AIU48367.1 pseudouridine synthase family protein, partial [Platanus x hispanica] Length = 310 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAPLFP+ Sbjct: 119 VHPCGQYRKNTVVGILQAEHDLAPLFPV 146 >AIU48331.1 pseudouridine synthase family protein, partial [Citrus clementina] Length = 310 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAPLFP+ Sbjct: 119 VHPCGQYRKNTVVGILQAEHDLAPLFPV 146 >XP_006436899.1 hypothetical protein CICLE_v10031733mg [Citrus clementina] ESR50139.1 hypothetical protein CICLE_v10031733mg [Citrus clementina] Length = 365 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAPLFP+ Sbjct: 156 VHPCGQYRKNTVVGILQAEHDLAPLFPV 183 >KDO64481.1 hypothetical protein CISIN_1g015203mg [Citrus sinensis] Length = 399 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAPLFP+ Sbjct: 162 VHPCGQYRKNTVVGILQAEHDLAPLFPV 189 >XP_006436898.1 hypothetical protein CICLE_v10031733mg [Citrus clementina] ESR50138.1 hypothetical protein CICLE_v10031733mg [Citrus clementina] Length = 399 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAPLFP+ Sbjct: 156 VHPCGQYRKNTVVGILQAEHDLAPLFPV 183 >KDO64480.1 hypothetical protein CISIN_1g015203mg [Citrus sinensis] Length = 411 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAPLFP+ Sbjct: 162 VHPCGQYRKNTVVGILQAEHDLAPLFPV 189 >XP_011083553.1 PREDICTED: RNA pseudouridine synthase 7 [Sesamum indicum] Length = 387 Score = 62.4 bits (150), Expect = 3e-08 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAP+FPI Sbjct: 137 VHPCGQYRKNTVVGILQAEHDLAPIFPI 164 >AIU48357.1 pseudouridine synthase family protein, partial [Ricinus communis] Length = 310 Score = 61.6 bits (148), Expect = 4e-08 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = -2 Query: 154 LYKQHPIFSVFHHSLCHFSDLI*VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 LYK + +V+ + + VHPCGQYRKNT+VGILQAEH+LAPLFP+ Sbjct: 102 LYKDPDVVTVYKPAT------VPVHPCGQYRKNTVVGILQAEHNLAPLFPV 146 >XP_002511129.1 PREDICTED: RNA pseudouridine synthase 7 [Ricinus communis] EEF51731.1 ribosomal pseudouridine synthase, putative [Ricinus communis] Length = 385 Score = 61.6 bits (148), Expect = 5e-08 Identities = 29/51 (56%), Positives = 37/51 (72%) Frame = -2 Query: 154 LYKQHPIFSVFHHSLCHFSDLI*VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 LYK + +V+ + + VHPCGQYRKNT+VGILQAEH+LAPLFP+ Sbjct: 121 LYKDPDVVTVYKPAT------VPVHPCGQYRKNTVVGILQAEHNLAPLFPV 165 >XP_016469598.1 PREDICTED: RNA pseudouridine synthase 7-like [Nicotiana tabacum] Length = 386 Score = 61.6 bits (148), Expect = 5e-08 Identities = 35/72 (48%), Positives = 45/72 (62%), Gaps = 9/72 (12%) Frame = -2 Query: 190 FVVRS*QPSMCALYKQHP-IFSVFHHSLCHFSDL--------I*VHPCGQYRKNTIVGIL 38 +VV+S Q L++ P + S LC D+ + VHPCGQYRKNT+VGIL Sbjct: 91 YVVQSSQKISHFLHRHEPPVMSWDVEILCEEPDVLTVCKPASVPVHPCGQYRKNTVVGIL 150 Query: 37 QAEHDLAPLFPI 2 QAE+DLAPLFP+ Sbjct: 151 QAEYDLAPLFPV 162 >XP_009600104.1 PREDICTED: RNA pseudouridine synthase 7 [Nicotiana tomentosiformis] Length = 386 Score = 61.6 bits (148), Expect = 5e-08 Identities = 35/72 (48%), Positives = 45/72 (62%), Gaps = 9/72 (12%) Frame = -2 Query: 190 FVVRS*QPSMCALYKQHP-IFSVFHHSLCHFSDL--------I*VHPCGQYRKNTIVGIL 38 +VV+S Q L++ P + S LC D+ + VHPCGQYRKNT+VGIL Sbjct: 91 YVVQSSQKISHFLHRHEPQVMSWDVEILCEEPDVLTVCKPASVPVHPCGQYRKNTVVGIL 150 Query: 37 QAEHDLAPLFPI 2 QAE+DLAPLFP+ Sbjct: 151 QAEYDLAPLFPV 162 >XP_010093931.1 RNA pseudourine synthase 7 [Morus notabilis] EXB54894.1 RNA pseudourine synthase 7 [Morus notabilis] Length = 399 Score = 61.6 bits (148), Expect = 5e-08 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGILQAEHDLAP+FP+ Sbjct: 150 VHPCGQYRKNTVVGILQAEHDLAPVFPV 177 >AIU48350.1 pseudouridine synthase family protein, partial [Erythranthe guttata] Length = 310 Score = 61.2 bits (147), Expect = 6e-08 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -2 Query: 85 VHPCGQYRKNTIVGILQAEHDLAPLFPI 2 VHPCGQYRKNT+VGIL+AEHDLAP+FPI Sbjct: 119 VHPCGQYRKNTVVGILEAEHDLAPIFPI 146