BLASTX nr result
ID: Panax25_contig00046891
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00046891 (376 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM96402.1 hypothetical protein DCAR_019644 [Daucus carota subsp... 57 1e-08 KZM91564.1 hypothetical protein DCAR_021071 [Daucus carota subsp... 55 6e-08 >KZM96402.1 hypothetical protein DCAR_019644 [Daucus carota subsp. sativus] Length = 61 Score = 57.0 bits (136), Expect = 1e-08 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = +3 Query: 57 MMSKIIPKSRFVMEVAPPQFISVIRRPLAKNLATINEEESENVRGSLSTSFNRS 218 MM+KI RFV EVAPP+FISVIRRP+ K LATI+EEESE SL S S Sbjct: 1 MMAKI-QTLRFVTEVAPPRFISVIRRPMKKLLATIHEEESEITGRSLPASLANS 53 >KZM91564.1 hypothetical protein DCAR_021071 [Daucus carota subsp. sativus] Length = 53 Score = 55.1 bits (131), Expect = 6e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +3 Query: 72 IPKSRFVMEVAPPQFISVIRRPLAKNLATINEEESENVRGSLSTSFNRS 218 +PK R V EV PP FIS++RRP+ K +ATI+EEE+E V SLS+SF S Sbjct: 4 VPKMRVVTEVIPPHFISLVRRPMEK-MATIDEEENEMVIRSLSSSFQLS 51