BLASTX nr result
ID: Panax25_contig00046498
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00046498 (411 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017225673.1 PREDICTED: pentatricopeptide repeat-containing pr... 130 7e-33 CDO99090.1 unnamed protein product [Coffea canephora] 84 4e-16 XP_012841762.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 2e-14 XP_015088188.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 4e-13 XP_004247584.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 4e-13 XP_010256135.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 9e-13 XP_010256134.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 9e-13 XP_006360761.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 9e-13 XP_016554977.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 1e-12 XP_016433260.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 2e-12 XP_009602615.1 PREDICTED: pentatricopeptide repeat-containing pr... 73 2e-12 XP_009802502.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 3e-12 XP_019224035.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 6e-12 XP_011073444.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 8e-12 XP_018818575.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 1e-11 XP_019198208.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 1e-11 XP_006492149.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 1e-08 KDO43059.1 hypothetical protein CISIN_1g009011mg [Citrus sinensis] 62 2e-08 XP_007221599.1 hypothetical protein PRUPE_ppa026817mg, partial [... 60 9e-08 ONI26335.1 hypothetical protein PRUPE_1G018400 [Prunus persica] 60 9e-08 >XP_017225673.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial-like [Daucus carota subsp. sativus] XP_017225674.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial-like [Daucus carota subsp. sativus] KZM83107.1 hypothetical protein DCAR_030676 [Daucus carota subsp. sativus] Length = 562 Score = 130 bits (327), Expect = 7e-33 Identities = 64/128 (50%), Positives = 89/128 (69%), Gaps = 19/128 (14%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLSESP 260 ML K K AFWRFR++ D+K+ RGDV+ NG+ + LC+SF ++T+S +VD++++L ESP Sbjct: 1 MLFKLAKFGAFWRFRTRFDVKVCRGDVYTRNGVCSLLCSSFSSMTMSKDVDEASNLVESP 60 Query: 261 ELPNWVKFAESGIDTTDPKDDFVLPSVSHWVDSH-------------------DVDKISR 383 ELP+WVKF+E G+ ++ P DDFVLPS+SHWVD + DVDKISR Sbjct: 61 ELPSWVKFSEKGVLSSSPDDDFVLPSISHWVDENKVLDLKVGLESQGGDVDGSDVDKISR 120 Query: 384 ILKDQFES 407 ILK+ F+S Sbjct: 121 ILKNPFDS 128 >CDO99090.1 unnamed protein product [Coffea canephora] Length = 574 Score = 83.6 bits (205), Expect = 4e-16 Identities = 47/129 (36%), Positives = 74/129 (57%), Gaps = 20/129 (15%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLS-ES 257 M S+ +FW FR++I + DV V+ +FL N FC + S++V+DS ++ ES Sbjct: 1 MPSRLRLFHSFWHFRARISSSRFTTDVRYVSDGNHFLWNPFCTVAESVQVEDSVVVTVES 60 Query: 258 PELPNWVKFAESGIDTTDPKDDFVLPSVSHWVDSHDV-------------------DKIS 380 P LP+WVK + + ++ + ++FVLPSVS W+DSH++ DKIS Sbjct: 61 PGLPHWVKSSNNEVNNVE-DEEFVLPSVSDWIDSHELHRPGVDTESKVGDLSDSEADKIS 119 Query: 381 RILKDQFES 407 +ILK +F+S Sbjct: 120 KILKSEFKS 128 >XP_012841762.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Erythranthe guttata] Length = 569 Score = 78.6 bits (192), Expect = 2e-14 Identities = 52/133 (39%), Positives = 74/133 (55%), Gaps = 24/133 (18%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDV-HPVNGMYNFLCNSFCNITVSLEVDDS-TDLSE 254 MLSKS +R+ + +Q+ L ++ D + NG+ L +FC L+VDDS T +E Sbjct: 1 MLSKSTHLRSLSQRHAQLCLNRFKQDCRNDSNGVGALLHKTFCTAAEPLKVDDSHTTKAE 60 Query: 255 SPELPNWVKFAESGID---TTDPKDDFVLPSVSHWVDSH-------------------DV 368 SPELP WVK SG D T DDF+ PSVS+W+++H D+ Sbjct: 61 SPELPGWVK--PSGKDKPPTKSDDDDFIPPSVSYWIENHKIRVQDIDMKSIVNDIVETDL 118 Query: 369 DKISRILKDQFES 407 DKIS++LK+QF+S Sbjct: 119 DKISKVLKNQFDS 131 >XP_015088188.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Solanum pennellii] Length = 574 Score = 75.1 bits (183), Expect = 4e-13 Identities = 43/131 (32%), Positives = 72/131 (54%), Gaps = 22/131 (16%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLSESP 260 M+S ++ FW +Q L ++R VH V+ + LC+ FC++T +++++ ++ESP Sbjct: 1 MISSLKRLPHFWCLGAQRRLYVWRSSVHYVSD--DLLCSRFCSMTETIDINQQRKVTESP 58 Query: 261 ELPNWVKFA---ESGIDTTDPKDDFVLPSVSHWVDS-------------------HDVDK 374 ELP+WV+ E+ + D DDF+LPS S WV + +DVDK Sbjct: 59 ELPDWVRIVKQEEAAVKLED--DDFLLPSFSEWVKNEKLRAREVDVRSLASDLTENDVDK 116 Query: 375 ISRILKDQFES 407 IS++L+ F+S Sbjct: 117 ISKVLRFNFKS 127 >XP_004247584.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Solanum lycopersicum] Length = 574 Score = 75.1 bits (183), Expect = 4e-13 Identities = 43/131 (32%), Positives = 72/131 (54%), Gaps = 22/131 (16%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLSESP 260 M+S ++ FW +Q L ++R VH V+ + LC+ FC++T +++++ ++ESP Sbjct: 1 MISSLKRLPHFWCLGAQRRLYVWRSSVHYVSD--DLLCSRFCSMTETIDINQQRKVTESP 58 Query: 261 ELPNWVKFA---ESGIDTTDPKDDFVLPSVSHWVDS-------------------HDVDK 374 ELP+WV+ E+ + D DDF+LPS S WV + +DVDK Sbjct: 59 ELPDWVRIVKQEEAAVKLED--DDFLLPSFSEWVKNEKLRAREVDVRSLASDLTENDVDK 116 Query: 375 ISRILKDQFES 407 IS++L+ F+S Sbjct: 117 ISKVLRFNFKS 127 >XP_010256135.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial isoform X2 [Nelumbo nucifera] Length = 549 Score = 73.9 bits (180), Expect = 9e-13 Identities = 44/115 (38%), Positives = 60/115 (52%), Gaps = 18/115 (15%) Frame = +3 Query: 117 RFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLSESPELPNWVKFAESG 296 RF ++ + G +HPVN +Y+ + FC I +ESPELP+WVKF + G Sbjct: 2 RFATRRTFSLCNGVIHPVNVVYHCIVKRFCGI------------NESPELPDWVKFPQDG 49 Query: 297 ID-TTDPKDDFVLPSVSHWVDSH-----------------DVDKISRILKDQFES 407 TD +DDFVLPS+ +WV + VDKISRILK++F S Sbjct: 50 SSPLTDSEDDFVLPSIVNWVRNQKEPDSETRCLPNEVIDDSVDKISRILKNRFSS 104 >XP_010256134.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial isoform X1 [Nelumbo nucifera] Length = 560 Score = 73.9 bits (180), Expect = 9e-13 Identities = 44/115 (38%), Positives = 60/115 (52%), Gaps = 18/115 (15%) Frame = +3 Query: 117 RFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLSESPELPNWVKFAESG 296 RF ++ + G +HPVN +Y+ + FC I +ESPELP+WVKF + G Sbjct: 13 RFATRRTFSLCNGVIHPVNVVYHCIVKRFCGI------------NESPELPDWVKFPQDG 60 Query: 297 ID-TTDPKDDFVLPSVSHWVDSH-----------------DVDKISRILKDQFES 407 TD +DDFVLPS+ +WV + VDKISRILK++F S Sbjct: 61 SSPLTDSEDDFVLPSIVNWVRNQKEPDSETRCLPNEVIDDSVDKISRILKNRFSS 115 >XP_006360761.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Solanum tuberosum] XP_015170466.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Solanum tuberosum] Length = 571 Score = 73.9 bits (180), Expect = 9e-13 Identities = 44/131 (33%), Positives = 68/131 (51%), Gaps = 22/131 (16%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLSESP 260 M+S + FW +Q L ++R VH V+ + LCN C +T ++ ++ ++ESP Sbjct: 1 MISSLKRFPHFWCLGAQRRLYVWRSSVHYVSD--DLLCNRLCTMTETININQQPKVTESP 58 Query: 261 ELPNWVKFA---ESGIDTTDPKDDFVLPSVSHWVDS-------------------HDVDK 374 ELP+WVK E+ + D DDF+LPS S WV + +DVDK Sbjct: 59 ELPDWVKIVKEEEAAVKLED--DDFLLPSFSEWVKNEKLRAREIDVRSLASDLTENDVDK 116 Query: 375 ISRILKDQFES 407 IS++L+ F+S Sbjct: 117 ISKVLRFNFKS 127 >XP_016554977.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial-like [Capsicum annuum] Length = 573 Score = 73.6 bits (179), Expect = 1e-12 Identities = 40/129 (31%), Positives = 68/129 (52%), Gaps = 20/129 (15%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLSESP 260 M++K + FW +Q L + R ++ V+ + LCN FC +T ++ + ++ESP Sbjct: 1 MITKLKRFPHFWCLGAQRLLNVRRSSIYHVSD--DLLCNRFCTVTKTINTNQQPTVTESP 58 Query: 261 ELPNWVKFAESGIDTTDPK-DDFVLPSVSHWVDS-------------------HDVDKIS 380 ELP+WV+ + +P+ DDF+LPS S W+ + +DVDKIS Sbjct: 59 ELPDWVRVVKEEEAVVEPEYDDFLLPSFSEWIKNEKLRAREVDVRGLVSDMTENDVDKIS 118 Query: 381 RILKDQFES 407 ++L+ F+S Sbjct: 119 KVLRFHFKS 127 >XP_016433260.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial-like [Nicotiana tabacum] Length = 573 Score = 73.2 bits (178), Expect = 2e-12 Identities = 45/131 (34%), Positives = 67/131 (51%), Gaps = 22/131 (16%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLSESP 260 M+S FW R++ L + R V+ V+ + LCN +C +T ++ D ++ESP Sbjct: 1 MISNLKHFPYFWCLRARRRLNVRRSSVYYVSD--DLLCNRYCTVTETVNTDQQPKVTESP 58 Query: 261 ELPNWVKFA---ESGIDTTDPKDDFVLPSVSHWVDSH-------------------DVDK 374 ELP+WVK E+ +D D DDF+LPS S WV + DVDK Sbjct: 59 ELPDWVKIVKKEETVVDFGD--DDFLLPSFSEWVKNEKLRAKEVDVRGLASDIADSDVDK 116 Query: 375 ISRILKDQFES 407 IS++L+ F+S Sbjct: 117 ISKLLRFHFKS 127 >XP_009602615.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Nicotiana tomentosiformis] XP_018626864.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Nicotiana tomentosiformis] Length = 573 Score = 73.2 bits (178), Expect = 2e-12 Identities = 45/131 (34%), Positives = 67/131 (51%), Gaps = 22/131 (16%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLSESP 260 M+S FW R++ L + R V+ V+ + LCN +C +T ++ D ++ESP Sbjct: 1 MISNLKHFPYFWCLRARRRLNVRRSSVYYVSD--DLLCNRYCTVTETVNTDQQPKVTESP 58 Query: 261 ELPNWVKFA---ESGIDTTDPKDDFVLPSVSHWVDSH-------------------DVDK 374 ELP+WVK E+ +D D DDF+LPS S WV + DVDK Sbjct: 59 ELPDWVKIVKKEETVVDFGD--DDFLLPSFSEWVKNEKLRAREVDVRGLASDIADSDVDK 116 Query: 375 ISRILKDQFES 407 IS++L+ F+S Sbjct: 117 ISKLLRFHFKS 127 >XP_009802502.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Nicotiana sylvestris] XP_009802503.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Nicotiana sylvestris] XP_016486450.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial-like [Nicotiana tabacum] XP_016486451.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial-like [Nicotiana tabacum] Length = 573 Score = 72.4 bits (176), Expect = 3e-12 Identities = 44/131 (33%), Positives = 67/131 (51%), Gaps = 22/131 (16%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLSESP 260 M+S FW R++ L ++R V+ V+ + LCN +C +T ++ D ++ESP Sbjct: 1 MISNLKHFPYFWCLRARRRLNVWRSSVYYVSD--DMLCNRYCTVTETVNTDQQPKMTESP 58 Query: 261 ELPNWVKFA---ESGIDTTDPKDDFVLPSVSHWVDSH-------------------DVDK 374 +LP WVK E+ +D D DDF+LPS S WV + DVDK Sbjct: 59 DLPVWVKIVKKEETVVDFGD--DDFLLPSFSEWVKNEKLRASEVDVRGLASDIADSDVDK 116 Query: 375 ISRILKDQFES 407 IS++L+ F+S Sbjct: 117 ISKLLRFHFKS 127 >XP_019224035.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Nicotiana attenuata] XP_019224037.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Nicotiana attenuata] OIT33646.1 pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 573 Score = 71.6 bits (174), Expect = 6e-12 Identities = 44/131 (33%), Positives = 68/131 (51%), Gaps = 22/131 (16%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLSESP 260 M+S FW R++ L ++R V+ V+ LCN +C +T ++ + ++ESP Sbjct: 1 MISNLKHFPYFWCLRARRRLNVWRSSVYYVSDY--LLCNRYCTVTETVNTNQLPKVTESP 58 Query: 261 ELPNWVKFA---ESGIDTTDPKDDFVLPSVSHWVDS-------------------HDVDK 374 ELP+WVK E+ +D D DDF+LPS S WV + +DVDK Sbjct: 59 ELPDWVKIVKKEETVVDFGD--DDFLLPSFSEWVKNEKLRAREVDVRGLASDIADNDVDK 116 Query: 375 ISRILKDQFES 407 IS++L+ F+S Sbjct: 117 ISKLLRFHFKS 127 >XP_011073444.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Sesamum indicum] XP_011073445.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Sesamum indicum] Length = 571 Score = 71.2 bits (173), Expect = 8e-12 Identities = 47/131 (35%), Positives = 71/131 (54%), Gaps = 22/131 (16%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLSESP 260 MLSKS + WR ++ + L + + G+ N ++FC + ++ +D + +ESP Sbjct: 1 MLSKSKIFCSLWRRQNPLSLS--QDFSSYIIGIGNLFHHAFCTVIEPIKANDLSHNAESP 58 Query: 261 ELPNWVKFAESGIDTTDPK---DDFVLPSVSHWVDSH-------------------DVDK 374 ELP+WVKF G ++++ K DDFV PSVS+W+++ DVDK Sbjct: 59 ELPDWVKF--PGKESSEGKVKDDDFVPPSVSYWIENQKIRYCDVDMKTVVNDIVESDVDK 116 Query: 375 ISRILKDQFES 407 ISRILK QF S Sbjct: 117 ISRILKQQFIS 127 >XP_018818575.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Juglans regia] Length = 551 Score = 70.9 bits (172), Expect = 1e-11 Identities = 39/95 (41%), Positives = 54/95 (56%), Gaps = 20/95 (21%) Frame = +3 Query: 183 NFLCNSFCNITVSLEVDDSTDLSESPELPNWVKF-AESGIDTTDPKDDFVLPSVSHWVDS 359 NFLCN FC DST ++ESPELP+WVKF A D +DFV+PS++HWV++ Sbjct: 28 NFLCNHFCTRI------DSTQITESPELPSWVKFGATQSSAAADSDEDFVVPSLAHWVEN 81 Query: 360 H-------------------DVDKISRILKDQFES 407 H DV+KIS+IL++++ S Sbjct: 82 HRLHDHGKVVKRMLSEAAETDVEKISKILQNRYPS 116 >XP_019198208.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial-like [Ipomoea nil] XP_019149734.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial-like [Ipomoea nil] Length = 580 Score = 70.9 bits (172), Expect = 1e-11 Identities = 44/128 (34%), Positives = 62/128 (48%), Gaps = 19/128 (14%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDVHPVNGMYNFLCNSFCNITVSLEVDDSTDLSESP 260 M+ K + FWR +S+ L + R +V+ G L N+ C +T EVD ++ESP Sbjct: 1 MILKFKHFQHFWRLQSREGLNLCRNNVYCGEGN-TMLTNTLCTVTGMSEVDKLPKMTESP 59 Query: 261 ELPNWVKFAESGIDTTD--PKDDFVLPSVSHWVDSH-----------------DVDKISR 383 ELP WVK TD DDFV+PS+ W+++ DVDKI Sbjct: 60 ELPGWVKLPGKSKQDTDMSEDDDFVIPSLWSWIENDKFQRQEVGANSLKSDIVDVDKIGE 119 Query: 384 ILKDQFES 407 LK+ F+S Sbjct: 120 TLKNHFKS 127 >XP_006492149.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22670, mitochondrial [Citrus sinensis] Length = 546 Score = 62.0 bits (149), Expect = 1e-08 Identities = 37/95 (38%), Positives = 51/95 (53%), Gaps = 20/95 (21%) Frame = +3 Query: 183 NFLCNSFCN-ITVSLEVDDSTDLSESPELPNWVKFAESGIDTTDPKDDFVLPSVSHWVDS 359 N+LC CN + + E ST ESP LP+W+KF D+ P +DFV+PS++ WV+S Sbjct: 23 NYLCYLSCNPLCTTAESPSST---ESPSLPSWIKF----FDSQSPDEDFVIPSLAGWVES 75 Query: 360 H-------------------DVDKISRILKDQFES 407 H DVDKIS+IL Q++S Sbjct: 76 HRLNEKSRISSRVLSENHETDVDKISKILSKQYQS 110 >KDO43059.1 hypothetical protein CISIN_1g009011mg [Citrus sinensis] Length = 546 Score = 61.6 bits (148), Expect = 2e-08 Identities = 44/129 (34%), Positives = 61/129 (47%), Gaps = 20/129 (15%) Frame = +3 Query: 81 MLSKSNKIRAFWRFRSQIDLKIYRGDVHPVNGMYNFLCNSFCN-ITVSLEVDDSTDLSES 257 ML K N ++ + Q KIY +LC CN + + E ST ES Sbjct: 1 MLPKHNILKLLSQSHLQKHAKIY------------YLCYLSCNPLCTTAESPSST---ES 45 Query: 258 PELPNWVKFAESGIDTTDPKDDFVLPSVSHWVDSH-------------------DVDKIS 380 P LP+W+KF D+ P +DFV+PS++ WV+SH DVDKIS Sbjct: 46 PSLPSWIKF----FDSQSPDEDFVIPSLAGWVESHRLNEKSRISSRVLSENHETDVDKIS 101 Query: 381 RILKDQFES 407 +IL Q++S Sbjct: 102 KILSKQYQS 110 >XP_007221599.1 hypothetical protein PRUPE_ppa026817mg, partial [Prunus persica] Length = 543 Score = 59.7 bits (143), Expect = 9e-08 Identities = 37/100 (37%), Positives = 51/100 (51%), Gaps = 25/100 (25%) Frame = +3 Query: 183 NFLCNSFCNITVSLEVDDSTDLSESPELPNWVKFAESGIDTTDPK-----DDFVLPSVSH 347 + LCN C +T V + T ESPELPNWVKF DT P+ +DFV+PS+++ Sbjct: 31 HLLCNPLCTLTEPTPVSEVT---ESPELPNWVKF----FDTKRPEKAVLDEDFVIPSLAN 83 Query: 348 WV--------------------DSHDVDKISRILKDQFES 407 WV D+ D+DK+ RILK+ + S Sbjct: 84 WVEAQKLRDPSKAVKRPLSETADTDDIDKVCRILKNGYPS 123 >ONI26335.1 hypothetical protein PRUPE_1G018400 [Prunus persica] Length = 550 Score = 59.7 bits (143), Expect = 9e-08 Identities = 37/100 (37%), Positives = 51/100 (51%), Gaps = 25/100 (25%) Frame = +3 Query: 183 NFLCNSFCNITVSLEVDDSTDLSESPELPNWVKFAESGIDTTDPK-----DDFVLPSVSH 347 + LCN C +T V + T ESPELPNWVKF DT P+ +DFV+PS+++ Sbjct: 23 HLLCNPLCTLTEPTPVSEVT---ESPELPNWVKF----FDTKRPEKAVLDEDFVIPSLAN 75 Query: 348 WV--------------------DSHDVDKISRILKDQFES 407 WV D+ D+DK+ RILK+ + S Sbjct: 76 WVEAQKLRDPSKAVKRPLSETADTDDIDKVCRILKNGYPS 115