BLASTX nr result
ID: Panax25_contig00046439
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00046439 (374 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017243686.1 PREDICTED: uncharacterized protein At1g04910-like... 63 5e-09 KZM98523.1 hypothetical protein DCAR_014115 [Daucus carota subsp... 63 5e-09 >XP_017243686.1 PREDICTED: uncharacterized protein At1g04910-like [Daucus carota subsp. sativus] Length = 566 Score = 62.8 bits (151), Expect = 5e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 SLYSNPLPECRCLWESQNSTLKWTDNIDIQDH 96 SLYSNPLPECRCLWE+QNSTLK T N+ IQDH Sbjct: 535 SLYSNPLPECRCLWEAQNSTLKLTHNVLIQDH 566 >KZM98523.1 hypothetical protein DCAR_014115 [Daucus carota subsp. sativus] Length = 566 Score = 62.8 bits (151), Expect = 5e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 SLYSNPLPECRCLWESQNSTLKWTDNIDIQDH 96 SLYSNPLPECRCLWE+QNSTLK T N+ IQDH Sbjct: 535 SLYSNPLPECRCLWEAQNSTLKLTHNVLIQDH 566