BLASTX nr result
ID: Panax25_contig00046354
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00046354 (415 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIT01347.1 hypothetical protein A4A49_01805 [Nicotiana attenuata] 55 1e-06 XP_016704161.1 PREDICTED: uncharacterized protein LOC107919151 [... 56 1e-06 >OIT01347.1 hypothetical protein A4A49_01805 [Nicotiana attenuata] Length = 190 Score = 55.5 bits (132), Expect = 1e-06 Identities = 30/75 (40%), Positives = 42/75 (56%), Gaps = 1/75 (1%) Frame = -1 Query: 307 QQDHLSPVLRRSTRVWRMPIFFNDYDLGHKNCNIVECFFTGPY-CDNESGSYEEAKYCPQ 131 ++D +RRSTR + P + DY++ N ++ CFFTG D E SYEEAK P Sbjct: 100 EEDGEQEAVRRSTREKKQPGYLKDYEVELNNHSVTSCFFTGALSADQEPLSYEEAKSFPH 159 Query: 130 WISAMEVKMAALLDN 86 W AM+ ++ AL N Sbjct: 160 WERAMQEEIDALDKN 174 >XP_016704161.1 PREDICTED: uncharacterized protein LOC107919151 [Gossypium hirsutum] Length = 448 Score = 56.2 bits (134), Expect = 1e-06 Identities = 33/82 (40%), Positives = 46/82 (56%), Gaps = 5/82 (6%) Frame = -1 Query: 286 VLRRSTRVWRMPIFFNDYDLGHKNCNIVECFFTGPYCDNESGSYEEAKYCPQWISAMEVK 107 VLR+S+R R+ DY++ C +V FF P D E S+EEAK P+W SAM+ + Sbjct: 67 VLRKSSRETRLASHLRDYEVQLNQCTVVSYFFI-PGMDEEPASFEEAKGYPEWKSAMDEE 125 Query: 106 MAALLDN-----VPKSNDVEPV 56 + AL N VPK + +PV Sbjct: 126 IEALNKNQTWELVPKPENCKPV 147