BLASTX nr result
ID: Panax25_contig00046245
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00046245 (722 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO81961.1 hypothetical protein CCACVL1_12132 [Corchorus capsula... 57 6e-06 >OMO81961.1 hypothetical protein CCACVL1_12132 [Corchorus capsularis] Length = 613 Score = 57.4 bits (137), Expect = 6e-06 Identities = 32/67 (47%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Frame = +2 Query: 26 IFFLKLRGINCTMVEFAKKRFDRYIICSSHQNRDHIVAVI-KRLACYIVVGMPTTAHEIK 202 +F KLRG M + K+R DR +ICSS N VA+ KRL C V+ MP T EIK Sbjct: 158 VFSFKLRGAYNMMAKLPKERLDRGVICSSAGNHAQGVALAAKRLGCDAVIAMPVTTPEIK 217 Query: 203 WKLVKTL 223 W+ VK L Sbjct: 218 WQSVKRL 224