BLASTX nr result
ID: Panax25_contig00046237
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00046237 (414 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMO54488.1 hypothetical protein CCACVL1_27769 [Corchorus capsula... 60 6e-08 XP_019436332.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 9e-08 XP_019436331.1 PREDICTED: pentatricopeptide repeat-containing pr... 60 9e-08 OMP01476.1 hypothetical protein COLO4_11833 [Corchorus olitorius] 59 1e-07 CDO98197.1 unnamed protein product [Coffea canephora] 58 2e-07 XP_006427518.1 hypothetical protein CICLE_v100269242mg, partial ... 56 1e-06 KDO41814.1 hypothetical protein CISIN_1g041804mg, partial [Citru... 56 1e-06 XP_015871592.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 1e-06 XP_008224178.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 1e-06 XP_006465271.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 1e-06 XP_007226356.1 hypothetical protein PRUPE_ppa022331mg [Prunus pe... 56 1e-06 XP_014502134.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 2e-06 XP_018844341.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 4e-06 EOY25970.1 Pentatricopeptide repeat (PPR) superfamily protein is... 55 4e-06 EOY25971.1 Pentatricopeptide repeat (PPR) superfamily protein is... 55 5e-06 XP_017977987.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 5e-06 XP_015067406.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 5e-06 XP_006344442.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 5e-06 XP_004236239.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 5e-06 XP_006590730.1 PREDICTED: pentatricopeptide repeat-containing pr... 54 7e-06 >OMO54488.1 hypothetical protein CCACVL1_27769 [Corchorus capsularis] Length = 451 Score = 60.1 bits (144), Expect = 6e-08 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREGSAD 311 DMARKYDEEMLAKGLS+KPR ELGTKLV+EG D Sbjct: 418 DMARKYDEEMLAKGLSSKPREELGTKLVQEGLDD 451 >XP_019436332.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial isoform X2 [Lupinus angustifolius] XP_019436333.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial isoform X3 [Lupinus angustifolius] Length = 490 Score = 59.7 bits (143), Expect = 9e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREGSAD 311 DMARKYDEEMLAKGL+AKPR ELGTKLV E AD Sbjct: 454 DMARKYDEEMLAKGLAAKPRKELGTKLVEEDCAD 487 >XP_019436331.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial isoform X1 [Lupinus angustifolius] Length = 504 Score = 59.7 bits (143), Expect = 9e-08 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREGSAD 311 DMARKYDEEMLAKGL+AKPR ELGTKLV E AD Sbjct: 468 DMARKYDEEMLAKGLAAKPRKELGTKLVEEDCAD 501 >OMP01476.1 hypothetical protein COLO4_11833 [Corchorus olitorius] Length = 451 Score = 59.3 bits (142), Expect = 1e-07 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREG 320 DMARKYDEEMLAKGLS+KPR ELGTKLV+EG Sbjct: 418 DMARKYDEEMLAKGLSSKPREELGTKLVQEG 448 >CDO98197.1 unnamed protein product [Coffea canephora] Length = 207 Score = 57.8 bits (138), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREGSAD 311 DMARKYDEEM+AKGLSAKPR ELGTKL+ G D Sbjct: 173 DMARKYDEEMMAKGLSAKPRVELGTKLISVGPED 206 >XP_006427518.1 hypothetical protein CICLE_v100269242mg, partial [Citrus clementina] ESR40758.1 hypothetical protein CICLE_v100269242mg, partial [Citrus clementina] Length = 290 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREG 320 DMARKYDEEM AKGLSAKPR ELGTKLV+ G Sbjct: 253 DMARKYDEEMFAKGLSAKPREELGTKLVQGG 283 >KDO41814.1 hypothetical protein CISIN_1g041804mg, partial [Citrus sinensis] Length = 403 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREG 320 DMARKYDEEM AKGLSAKPR ELGTKLV+ G Sbjct: 366 DMARKYDEEMFAKGLSAKPREELGTKLVQGG 396 >XP_015871592.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial [Ziziphus jujuba] Length = 453 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/34 (82%), Positives = 28/34 (82%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREGSAD 311 DMAR YDEEMLAKGLSAKPR ELGT LVR G D Sbjct: 419 DMARLYDEEMLAKGLSAKPREELGTTLVRRGPDD 452 >XP_008224178.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial [Prunus mume] Length = 455 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREGSAD 311 DMAR+YDEEMLAKGLSAKPR ELGTKLV S D Sbjct: 421 DMARQYDEEMLAKGLSAKPREELGTKLVSSESDD 454 >XP_006465271.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial [Citrus sinensis] Length = 455 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREG 320 DMARKYDEEM AKGLSAKPR ELGTKLV+ G Sbjct: 418 DMARKYDEEMFAKGLSAKPREELGTKLVQGG 448 >XP_007226356.1 hypothetical protein PRUPE_ppa022331mg [Prunus persica] ONI26795.1 hypothetical protein PRUPE_1G046400 [Prunus persica] Length = 455 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREGSAD 311 DMAR+YDEEMLAKGLSAKPR ELGTKLV S D Sbjct: 421 DMARQYDEEMLAKGLSAKPREELGTKLVSSESDD 454 >XP_014502134.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Vigna radiata var. radiata] XP_014502135.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Vigna radiata var. radiata] XP_014502136.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Vigna radiata var. radiata] XP_014502137.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Vigna radiata var. radiata] XP_014502139.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Vigna radiata var. radiata] XP_014502140.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Vigna radiata var. radiata] XP_014502141.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Vigna radiata var. radiata] Length = 455 Score = 55.8 bits (133), Expect = 2e-06 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREGSAD 311 DMARKYDEEMLAKGLS KPR ELGTKL+ SAD Sbjct: 407 DMARKYDEEMLAKGLSPKPRKELGTKLLGGESAD 440 >XP_018844341.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial [Juglans regia] Length = 450 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/35 (80%), Positives = 28/35 (80%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREGSADS 308 DMARKYDEEMLAKG SAKPR ELG KLV S DS Sbjct: 414 DMARKYDEEMLAKGFSAKPRAELGRKLVGGESLDS 448 >EOY25970.1 Pentatricopeptide repeat (PPR) superfamily protein isoform 2 [Theobroma cacao] Length = 340 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREG 320 DMARKYDEEML KGLS+KPR ELGTKLV+ G Sbjct: 307 DMARKYDEEMLEKGLSSKPREELGTKLVQGG 337 >EOY25971.1 Pentatricopeptide repeat (PPR) superfamily protein isoform 3 [Theobroma cacao] Length = 360 Score = 54.7 bits (130), Expect = 5e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREG 320 DMARKYDEEML KGLS+KPR ELGTKLV+ G Sbjct: 327 DMARKYDEEMLEKGLSSKPREELGTKLVQGG 357 >XP_017977987.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial [Theobroma cacao] XP_017977988.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial [Theobroma cacao] XP_017977989.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial [Theobroma cacao] Length = 453 Score = 54.7 bits (130), Expect = 5e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREG 320 DMARKYDEEML KGLS+KPR ELGTKLV+ G Sbjct: 420 DMARKYDEEMLEKGLSSKPREELGTKLVQGG 450 >XP_015067406.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial [Solanum pennellii] Length = 467 Score = 54.7 bits (130), Expect = 5e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKL 332 DMARKYDEEMLAKGLSAKPR ELGTKL Sbjct: 433 DMARKYDEEMLAKGLSAKPRVELGTKL 459 >XP_006344442.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Solanum tuberosum] Length = 467 Score = 54.7 bits (130), Expect = 5e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKL 332 DMARKYDEEMLAKGLSAKPR ELGTKL Sbjct: 433 DMARKYDEEMLAKGLSAKPRVELGTKL 459 >XP_004236239.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial [Solanum lycopersicum] Length = 467 Score = 54.7 bits (130), Expect = 5e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKL 332 DMARKYDEEMLAKGLSAKPR ELGTKL Sbjct: 433 DMARKYDEEMLAKGLSAKPRVELGTKL 459 >XP_006590730.1 PREDICTED: pentatricopeptide repeat-containing protein At1g80550, mitochondrial-like [Glycine max] KRH28820.1 hypothetical protein GLYMA_11G078800 [Glycine max] Length = 449 Score = 54.3 bits (129), Expect = 7e-06 Identities = 26/42 (61%), Positives = 32/42 (76%) Frame = -3 Query: 412 DMARKYDEEMLAKGLSAKPRTELGTKLVREGSADS*LNSEFH 287 DMARKYDEEMLAKGLS KPR ELGTKL+ + S + ++ + Sbjct: 408 DMARKYDEEMLAKGLSPKPRKELGTKLLAADESQSTIQTQHY 449