BLASTX nr result
ID: Panax25_contig00046139
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00046139 (429 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017217781.1 PREDICTED: putative invertase inhibitor [Daucus c... 75 5e-14 XP_009803635.1 PREDICTED: putative invertase inhibitor [Nicotian... 70 5e-12 XP_012831381.1 PREDICTED: putative invertase inhibitor [Erythran... 68 2e-11 XP_016450878.1 PREDICTED: putative invertase inhibitor [Nicotian... 67 7e-11 XP_009613428.1 PREDICTED: putative invertase inhibitor [Nicotian... 67 7e-11 XP_019240200.1 PREDICTED: putative invertase inhibitor [Nicotian... 65 2e-10 XP_015085841.1 PREDICTED: putative invertase inhibitor [Solanum ... 65 4e-10 XP_004229708.1 PREDICTED: putative invertase inhibitor [Solanum ... 64 1e-09 XP_006354680.1 PREDICTED: putative invertase inhibitor [Solanum ... 63 2e-09 KZV43516.1 invertase inhibitor [Dorcoceras hygrometricum] 62 3e-09 XP_006354637.1 PREDICTED: putative invertase inhibitor [Solanum ... 62 5e-09 CAA56643.1 sts15 [Solanum tuberosum] 62 5e-09 XP_016544274.1 PREDICTED: putative invertase inhibitor [Capsicum... 60 1e-08 XP_011085383.1 PREDICTED: putative invertase inhibitor [Sesamum ... 60 2e-08 XP_011093482.1 PREDICTED: putative invertase inhibitor [Sesamum ... 59 4e-08 XP_012833940.1 PREDICTED: putative invertase inhibitor [Erythran... 59 8e-08 KVH22981.1 Pectinesterase inhibitor [Cynara cardunculus var. sco... 59 8e-08 EPS72175.1 hypothetical protein M569_02589, partial [Genlisea au... 58 1e-07 ABI17896.1 invertase inhibitor [Coffea canephora] 57 3e-07 CDP09379.1 unnamed protein product [Coffea canephora] 57 5e-07 >XP_017217781.1 PREDICTED: putative invertase inhibitor [Daucus carota subsp. sativus] KZM87923.1 hypothetical protein DCAR_025024 [Daucus carota subsp. sativus] Length = 193 Score = 75.1 bits (183), Expect = 5e-14 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -2 Query: 125 ATAQTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 +T+QTLIQNTCKT S +DPN+PYGFCTTSL AAPASRCASL Sbjct: 24 STSQTLIQNTCKTCSDEDPNVPYGFCTTSLFAAPASRCASL 64 >XP_009803635.1 PREDICTED: putative invertase inhibitor [Nicotiana sylvestris] XP_016458528.1 PREDICTED: putative invertase inhibitor [Nicotiana tabacum] Length = 189 Score = 69.7 bits (169), Expect = 5e-12 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -2 Query: 119 AQTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 AQ LIQNTCKT SK DPNI YGFCT+SLQAAPAS+CA+L Sbjct: 27 AQNLIQNTCKTCSKDDPNIKYGFCTSSLQAAPASQCATL 65 >XP_012831381.1 PREDICTED: putative invertase inhibitor [Erythranthe guttata] EYU42317.1 hypothetical protein MIMGU_mgv1a026284mg [Erythranthe guttata] Length = 182 Score = 68.2 bits (165), Expect = 2e-11 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -2 Query: 122 TAQTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 +AQTLI TCKT S DPNIPY FCTTSL AAPASRCA+L Sbjct: 19 SAQTLINTTCKTASNDDPNIPYAFCTTSLLAAPASRCAAL 58 >XP_016450878.1 PREDICTED: putative invertase inhibitor [Nicotiana tabacum] Length = 190 Score = 66.6 bits (161), Expect = 7e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 113 TLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 TLIQNTCKT SK DPNI +GFCT+SLQAAPAS+CA+L Sbjct: 30 TLIQNTCKTCSKDDPNIKFGFCTSSLQAAPASQCATL 66 >XP_009613428.1 PREDICTED: putative invertase inhibitor [Nicotiana tomentosiformis] Length = 190 Score = 66.6 bits (161), Expect = 7e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -2 Query: 113 TLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 TLIQNTCKT SK DPNI +GFCT+SLQAAPAS+CA+L Sbjct: 30 TLIQNTCKTCSKDDPNIKFGFCTSSLQAAPASQCATL 66 >XP_019240200.1 PREDICTED: putative invertase inhibitor [Nicotiana attenuata] OIT20422.1 putative invertase inhibitor [Nicotiana attenuata] Length = 189 Score = 65.5 bits (158), Expect = 2e-10 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = -2 Query: 116 QTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 Q LIQNTCKT SK DPNI Y FCT+SLQAAPAS+CA+L Sbjct: 28 QNLIQNTCKTCSKDDPNIKYDFCTSSLQAAPASQCATL 65 >XP_015085841.1 PREDICTED: putative invertase inhibitor [Solanum pennellii] Length = 189 Score = 64.7 bits (156), Expect = 4e-10 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -2 Query: 116 QTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 Q LIQNTCK+ S DPNI YGFCT+SLQAAPAS+CA+L Sbjct: 25 QNLIQNTCKSCSNDDPNIKYGFCTSSLQAAPASQCATL 62 >XP_004229708.1 PREDICTED: putative invertase inhibitor [Solanum lycopersicum] Length = 186 Score = 63.5 bits (153), Expect = 1e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 Query: 116 QTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 Q LIQNTCK+ + DPNI YGFCT+SLQAAPAS+CA+L Sbjct: 25 QNLIQNTCKSCANDDPNIKYGFCTSSLQAAPASQCATL 62 >XP_006354680.1 PREDICTED: putative invertase inhibitor [Solanum tuberosum] Length = 188 Score = 62.8 bits (151), Expect = 2e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -2 Query: 116 QTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 Q LIQNTCK+ SK DPNI Y FCT+S+QAAPAS+CA+L Sbjct: 25 QNLIQNTCKSCSKDDPNIKYEFCTSSIQAAPASQCATL 62 >KZV43516.1 invertase inhibitor [Dorcoceras hygrometricum] Length = 186 Score = 62.4 bits (150), Expect = 3e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -2 Query: 119 AQTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 +Q LI +TC+T SK DPNI Y FCT+SLQAAPASRCA+L Sbjct: 25 SQDLIHSTCQTSSKTDPNINYNFCTSSLQAAPASRCAAL 63 >XP_006354637.1 PREDICTED: putative invertase inhibitor [Solanum tuberosum] Length = 183 Score = 61.6 bits (148), Expect = 5e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -2 Query: 125 ATAQTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 +TAQ LIQ TCK+ SK + +I YGFCT+SLQAAPAS+CA+L Sbjct: 21 STAQNLIQTTCKSCSKNESSITYGFCTSSLQAAPASQCATL 61 >CAA56643.1 sts15 [Solanum tuberosum] Length = 183 Score = 61.6 bits (148), Expect = 5e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -2 Query: 125 ATAQTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 +TAQ LIQ TCK+ SK + +I YGFCT+SLQAAPAS+CA+L Sbjct: 21 STAQNLIQTTCKSCSKNESSITYGFCTSSLQAAPASQCATL 61 >XP_016544274.1 PREDICTED: putative invertase inhibitor [Capsicum annuum] Length = 165 Score = 60.5 bits (145), Expect = 1e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -2 Query: 110 LIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 LI+NTCKT SK PNI Y FCT+SLQAAPAS CASL Sbjct: 9 LIENTCKTCSKDGPNIKYDFCTSSLQAAPASECASL 44 >XP_011085383.1 PREDICTED: putative invertase inhibitor [Sesamum indicum] Length = 186 Score = 60.1 bits (144), Expect = 2e-08 Identities = 27/37 (72%), Positives = 31/37 (83%) Frame = -2 Query: 116 QTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCAS 6 Q LI +TC+T SK DPNI Y FCTTSLQAAPAS+CA+ Sbjct: 27 QRLINSTCETFSKNDPNIDYNFCTTSLQAAPASQCAT 63 >XP_011093482.1 PREDICTED: putative invertase inhibitor [Sesamum indicum] Length = 185 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 116 QTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 Q +I +TCKT DPNI Y FCTTSLQAAPASRCA+L Sbjct: 26 QNMINSTCKTSVINDPNINYDFCTTSLQAAPASRCATL 63 >XP_012833940.1 PREDICTED: putative invertase inhibitor [Erythranthe guttata] EYU40322.1 hypothetical protein MIMGU_mgv1a014543mg [Erythranthe guttata] Length = 186 Score = 58.5 bits (140), Expect = 8e-08 Identities = 28/38 (73%), Positives = 30/38 (78%) Frame = -2 Query: 116 QTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 + LI TCKT SK DPNI Y FCTTSLQAA ASRCA+L Sbjct: 27 ENLITTTCKTLSKNDPNINYTFCTTSLQAAAASRCATL 64 >KVH22981.1 Pectinesterase inhibitor [Cynara cardunculus var. scolymus] Length = 187 Score = 58.5 bits (140), Expect = 8e-08 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 116 QTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 Q +I +TCKT S+QDPN+ FCTTSLQAAPAS CA L Sbjct: 26 QNIIYDTCKTSSQQDPNVNLQFCTTSLQAAPASHCADL 63 >EPS72175.1 hypothetical protein M569_02589, partial [Genlisea aurea] Length = 164 Score = 57.8 bits (138), Expect = 1e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -2 Query: 116 QTLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCAS 6 QTLI +TCK +K+DPNI Y FCTTSLQ+APAS CA+ Sbjct: 1 QTLIASTCKKLAKEDPNIHYAFCTTSLQSAPASPCAA 37 >ABI17896.1 invertase inhibitor [Coffea canephora] Length = 185 Score = 57.0 bits (136), Expect = 3e-07 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = -2 Query: 125 ATAQ-TLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 AT+Q LI+++C+T +K DPNI + FCTTSLQAAPAS CA+L Sbjct: 22 ATSQENLIRDSCRTFAKDDPNINFNFCTTSLQAAPASHCAAL 63 >CDP09379.1 unnamed protein product [Coffea canephora] Length = 206 Score = 56.6 bits (135), Expect = 5e-07 Identities = 27/42 (64%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = -2 Query: 125 ATAQ-TLIQNTCKTGSKQDPNIPYGFCTTSLQAAPASRCASL 3 AT+Q LI+ +C+T +K DPNI + FCTTSLQAAPAS CA+L Sbjct: 22 ATSQENLIRESCRTFAKDDPNINFNFCTTSLQAAPASHCAAL 63