BLASTX nr result
ID: Panax25_contig00045205
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00045205 (470 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010245079.1 PREDICTED: transmembrane protein 50 homolog [Nelu... 58 6e-08 KZM89509.1 hypothetical protein DCAR_023128 [Daucus carota subsp... 57 7e-08 XP_016470134.1 PREDICTED: transmembrane protein 50 homolog [Nico... 56 1e-07 CDP20983.1 unnamed protein product [Coffea canephora] 57 1e-07 KDO80807.1 hypothetical protein CISIN_1g032718mg [Citrus sinensis] 57 1e-07 KGN50994.1 hypothetical protein Csa_5G387940 [Cucumis sativus] 55 2e-07 OMO62929.1 hypothetical protein COLO4_32811 [Corchorus olitorius... 57 2e-07 JAT43763.1 Transmembrane protein 50A [Anthurium amnicola] JAT585... 57 2e-07 XP_011097572.1 PREDICTED: transmembrane protein 50 homolog [Sesa... 57 2e-07 XP_006472700.1 PREDICTED: transmembrane protein 50 homolog [Citr... 57 2e-07 XP_006434104.1 hypothetical protein CICLE_v10002818mg [Citrus cl... 57 2e-07 EOY16163.1 Uncharacterized protein TCM_035011 isoform 2, partial... 56 2e-07 KVH99310.1 Uncharacterized protein family UPF0220 [Cynara cardun... 58 3e-07 GAV59326.1 UPF0220 domain-containing protein [Cephalotus follicu... 56 3e-07 XP_007018937.2 PREDICTED: transmembrane protein 50A [Theobroma c... 56 3e-07 OAY23365.1 hypothetical protein MANES_18G073000 [Manihot esculenta] 56 3e-07 XP_015571620.1 PREDICTED: transmembrane protein 50A [Ricinus com... 56 3e-07 XP_011027625.1 PREDICTED: transmembrane protein 50A-like [Populu... 56 3e-07 XP_002302262.1 hypothetical protein POPTR_0002s08980g [Populus t... 56 3e-07 EOY16162.1 Uncharacterized protein TCM_035011 isoform 1 [Theobro... 56 3e-07 >XP_010245079.1 PREDICTED: transmembrane protein 50 homolog [Nelumbo nucifera] Length = 135 Score = 58.2 bits (139), Expect = 6e-08 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 LAALMFNCVRREDIDYSPYEEGEWR Sbjct: 50 LAALMFNCVRREDIDYSPYEEGEWR 74 >KZM89509.1 hypothetical protein DCAR_023128 [Daucus carota subsp. sativus] Length = 82 Score = 56.6 bits (135), Expect = 7e-08 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWRSVCIS 90 LAALMFNCVRREDIDYSPY++GEW S+C S Sbjct: 50 LAALMFNCVRREDIDYSPYDDGEW-SICAS 78 >XP_016470134.1 PREDICTED: transmembrane protein 50 homolog [Nicotiana tabacum] Length = 76 Score = 55.8 bits (133), Expect = 1e-07 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 LAALMFNCVR+EDIDYSPY+EGEWR Sbjct: 50 LAALMFNCVRKEDIDYSPYDEGEWR 74 >CDP20983.1 unnamed protein product [Coffea canephora] Length = 124 Score = 57.0 bits (136), Expect = 1e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 LAALMFNCVR+EDIDYSPYEEGEWR Sbjct: 49 LAALMFNCVRKEDIDYSPYEEGEWR 73 >KDO80807.1 hypothetical protein CISIN_1g032718mg [Citrus sinensis] Length = 125 Score = 57.0 bits (136), Expect = 1e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 LAALMFNCVR+EDIDYSPYEEGEWR Sbjct: 50 LAALMFNCVRKEDIDYSPYEEGEWR 74 >KGN50994.1 hypothetical protein Csa_5G387940 [Cucumis sativus] Length = 74 Score = 55.5 bits (132), Expect = 2e-07 Identities = 23/24 (95%), Positives = 24/24 (100%) Frame = +1 Query: 4 AALMFNCVRREDIDYSPYEEGEWR 75 AALMFNCVR+EDIDYSPYEEGEWR Sbjct: 51 AALMFNCVRKEDIDYSPYEEGEWR 74 >OMO62929.1 hypothetical protein COLO4_32811 [Corchorus olitorius] OMO72840.1 hypothetical protein CCACVL1_17567 [Corchorus capsularis] Length = 135 Score = 57.0 bits (136), Expect = 2e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 LAALMFNCVR+EDIDYSPYEEGEWR Sbjct: 50 LAALMFNCVRKEDIDYSPYEEGEWR 74 >JAT43763.1 Transmembrane protein 50A [Anthurium amnicola] JAT58502.1 Transmembrane protein 50A [Anthurium amnicola] Length = 135 Score = 57.0 bits (136), Expect = 2e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 +AALMFNCVRREDIDYSPYEEGEWR Sbjct: 50 VAALMFNCVRREDIDYSPYEEGEWR 74 >XP_011097572.1 PREDICTED: transmembrane protein 50 homolog [Sesamum indicum] Length = 135 Score = 57.0 bits (136), Expect = 2e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 LAALMFNCVR+EDIDYSPYEEGEWR Sbjct: 50 LAALMFNCVRKEDIDYSPYEEGEWR 74 >XP_006472700.1 PREDICTED: transmembrane protein 50 homolog [Citrus sinensis] KDO80806.1 hypothetical protein CISIN_1g032718mg [Citrus sinensis] Length = 135 Score = 57.0 bits (136), Expect = 2e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 LAALMFNCVR+EDIDYSPYEEGEWR Sbjct: 50 LAALMFNCVRKEDIDYSPYEEGEWR 74 >XP_006434104.1 hypothetical protein CICLE_v10002818mg [Citrus clementina] ESR47344.1 hypothetical protein CICLE_v10002818mg [Citrus clementina] Length = 135 Score = 57.0 bits (136), Expect = 2e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 LAALMFNCVR+EDIDYSPYEEGEWR Sbjct: 50 LAALMFNCVRKEDIDYSPYEEGEWR 74 >EOY16163.1 Uncharacterized protein TCM_035011 isoform 2, partial [Theobroma cacao] Length = 118 Score = 56.2 bits (134), Expect = 2e-07 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 +AALMFNCVR+EDIDYSPYEEGEWR Sbjct: 35 IAALMFNCVRKEDIDYSPYEEGEWR 59 >KVH99310.1 Uncharacterized protein family UPF0220 [Cynara cardunculus var. scolymus] Length = 246 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 LAALMFNCVRREDIDYSPYEEGEWR Sbjct: 171 LAALMFNCVRREDIDYSPYEEGEWR 195 >GAV59326.1 UPF0220 domain-containing protein [Cephalotus follicularis] Length = 135 Score = 56.2 bits (134), Expect = 3e-07 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 +AALMFNCVR+EDIDYSPYEEGEWR Sbjct: 50 IAALMFNCVRKEDIDYSPYEEGEWR 74 >XP_007018937.2 PREDICTED: transmembrane protein 50A [Theobroma cacao] Length = 135 Score = 56.2 bits (134), Expect = 3e-07 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 +AALMFNCVR+EDIDYSPYEEGEWR Sbjct: 50 IAALMFNCVRKEDIDYSPYEEGEWR 74 >OAY23365.1 hypothetical protein MANES_18G073000 [Manihot esculenta] Length = 135 Score = 56.2 bits (134), Expect = 3e-07 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 +AALMFNCVR+EDIDYSPYEEGEWR Sbjct: 50 IAALMFNCVRKEDIDYSPYEEGEWR 74 >XP_015571620.1 PREDICTED: transmembrane protein 50A [Ricinus communis] XP_015571621.1 PREDICTED: transmembrane protein 50A [Ricinus communis] Length = 135 Score = 56.2 bits (134), Expect = 3e-07 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 +AALMFNCVR+EDIDYSPYEEGEWR Sbjct: 50 IAALMFNCVRKEDIDYSPYEEGEWR 74 >XP_011027625.1 PREDICTED: transmembrane protein 50A-like [Populus euphratica] Length = 135 Score = 56.2 bits (134), Expect = 3e-07 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 +AALMFNCVR+EDIDYSPYEEGEWR Sbjct: 50 IAALMFNCVRKEDIDYSPYEEGEWR 74 >XP_002302262.1 hypothetical protein POPTR_0002s08980g [Populus trichocarpa] EEE81535.1 hypothetical protein POPTR_0002s08980g [Populus trichocarpa] Length = 135 Score = 56.2 bits (134), Expect = 3e-07 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 +AALMFNCVR+EDIDYSPYEEGEWR Sbjct: 50 IAALMFNCVRKEDIDYSPYEEGEWR 74 >EOY16162.1 Uncharacterized protein TCM_035011 isoform 1 [Theobroma cacao] Length = 135 Score = 56.2 bits (134), Expect = 3e-07 Identities = 23/25 (92%), Positives = 25/25 (100%) Frame = +1 Query: 1 LAALMFNCVRREDIDYSPYEEGEWR 75 +AALMFNCVR+EDIDYSPYEEGEWR Sbjct: 50 IAALMFNCVRKEDIDYSPYEEGEWR 74