BLASTX nr result
ID: Panax25_contig00044655
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00044655 (390 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMP03610.1 hypothetical protein COLO4_10306 [Corchorus olitorius] 75 4e-13 OMO72680.1 hypothetical protein CCACVL1_17666 [Corchorus capsula... 72 5e-12 XP_007027170.2 PREDICTED: pentatricopeptide repeat-containing pr... 72 5e-12 EOY07672.1 Pentatricopeptide repeat (PPR) superfamily protein, p... 72 5e-12 XP_012486144.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 3e-10 XP_008241927.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 3e-10 XP_016671134.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 3e-10 XP_017608585.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 1e-09 XP_016669754.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 2e-09 XP_009341910.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 3e-09 XP_008387694.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 3e-09 XP_004305232.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 3e-09 XP_002273893.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 3e-09 XP_004497438.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 3e-09 XP_004497436.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 3e-09 XP_007208103.1 hypothetical protein PRUPE_ppa001024mg [Prunus pe... 63 7e-09 XP_015899544.1 PREDICTED: pentatricopeptide repeat-containing pr... 62 9e-09 GAU38027.1 hypothetical protein TSUD_395870 [Trifolium subterran... 62 2e-08 KDO47493.1 hypothetical protein CISIN_1g012234mg [Citrus sinensis] 61 2e-08 XP_015949274.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 61 2e-08 >OMP03610.1 hypothetical protein COLO4_10306 [Corchorus olitorius] Length = 559 Score = 74.7 bits (182), Expect = 4e-13 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEESV 150 IE G LQ FIAKD S+ERTEEI+V+LEGLL LM++EGY L DEFDEESV Sbjct: 508 IETSGGLQSFIAKDKSSERTEEIYVLLEGLLGLMKEEGYTLQDEFDEESV 557 >OMO72680.1 hypothetical protein CCACVL1_17666 [Corchorus capsularis] Length = 656 Score = 71.6 bits (174), Expect = 5e-12 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEESV 150 IE G LQ FIAKD S+ERTEEI+ +LEGLL LM++EGY L DEFDEESV Sbjct: 605 IETSGGLQSFIAKDKSSERTEEIYDLLEGLLGLMKEEGYALQDEFDEESV 654 >XP_007027170.2 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Theobroma cacao] Length = 667 Score = 71.6 bits (174), Expect = 5e-12 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEESV 150 IE G LQ FIAKD S+ERTEEI+V+LEGLL LM++EGY L DE+DEE+V Sbjct: 616 IETSGGLQSFIAKDRSSERTEEIYVLLEGLLGLMKEEGYTLHDEYDEENV 665 >EOY07672.1 Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 667 Score = 71.6 bits (174), Expect = 5e-12 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEESV 150 IE G LQ FIAKD S+ERTEEI+V+LEGLL LM++EGY L DE+DEE+V Sbjct: 616 IETSGGLQSFIAKDRSSERTEEIYVLLEGLLGLMKEEGYTLHDEYDEENV 665 >XP_012486144.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Gossypium raimondii] KJB36809.1 hypothetical protein B456_006G177200 [Gossypium raimondii] Length = 664 Score = 66.6 bits (161), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEESV 150 IE LQ FIAKD S+ERTEEI+ +LEGLL LM++EGY L D+FDEESV Sbjct: 612 IETSVGLQSFIAKDRSSERTEEIYSLLEGLLGLMKEEGYTLHDKFDEESV 661 >XP_008241927.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Prunus mume] Length = 667 Score = 66.6 bits (161), Expect = 3e-10 Identities = 34/52 (65%), Positives = 40/52 (76%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEESVGS 156 IE LQ FIAKD SN RTEEI+ ILEGLL LM+++GY L+DE DEESV + Sbjct: 616 IETSDGLQSFIAKDTSNGRTEEIYEILEGLLGLMKEKGYVLLDELDEESVNN 667 >XP_016671134.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Gossypium hirsutum] Length = 680 Score = 66.6 bits (161), Expect = 3e-10 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEESV 150 IE LQ FIAKD S+ERTEEI+ +LEGLL LM++EGY L D+FDEESV Sbjct: 628 IETSVGLQSFIAKDRSSERTEEIYSLLEGLLGLMKEEGYTLHDKFDEESV 677 >XP_017608585.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Gossypium arboreum] Length = 664 Score = 64.7 bits (156), Expect = 1e-09 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEESV 150 IE LQ FIAKD S+ER EEI+ +LEGLL LM++EGY L D+FDEESV Sbjct: 612 IETSVGLQNFIAKDRSSERIEEIYSLLEGLLGLMKEEGYTLHDKFDEESV 661 >XP_016669754.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Gossypium hirsutum] Length = 664 Score = 64.3 bits (155), Expect = 2e-09 Identities = 33/50 (66%), Positives = 39/50 (78%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEESV 150 IE LQ FIAKD S+ER EEI+ +LEGLL LM++EGY L D+FDEESV Sbjct: 612 IETSVGLQSFIAKDRSSERIEEIYSLLEGLLGLMKEEGYTLHDKFDEESV 661 >XP_009341910.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Pyrus x bretschneideri] Length = 667 Score = 63.9 bits (154), Expect = 3e-09 Identities = 32/50 (64%), Positives = 37/50 (74%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEESV 150 IE LQ FI KD SNERTEEI+ LEGLL +M+++GY L DE DEESV Sbjct: 616 IETSKGLQSFIVKDTSNERTEEIYETLEGLLGMMKEKGYALQDELDEESV 665 >XP_008387694.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Malus domestica] Length = 678 Score = 63.9 bits (154), Expect = 3e-09 Identities = 31/52 (59%), Positives = 38/52 (73%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEESVGS 156 IE LQ FI KD SNERTEEI+ LEGLL +M+++GY L DE DEES+ + Sbjct: 616 IETSKGLQSFIVKDTSNERTEEIYETLEGLLGMMKEKGYALQDELDEESISA 667 >XP_004305232.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Fragaria vesca subsp. vesca] Length = 664 Score = 63.5 bits (153), Expect = 3e-09 Identities = 32/50 (64%), Positives = 39/50 (78%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEESV 150 IE L FIA+DASNERTE I+ ILEGLL LM+++GY L++E DEESV Sbjct: 612 IETSDGLHSFIARDASNERTEAIYEILEGLLGLMKEKGYVLLEELDEESV 661 >XP_002273893.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310 [Vitis vinifera] Length = 667 Score = 63.5 bits (153), Expect = 3e-09 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEE 144 IE G L+ FIA+D S+ER+EEI+ +LEGLL LMR+EGY L DE DEE Sbjct: 616 IETSGGLRSFIARDVSSERSEEIYGMLEGLLGLMREEGYTLQDELDEE 663 >XP_004497438.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Cicer arietinum] Length = 668 Score = 63.5 bits (153), Expect = 3e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEE 144 IE GRLQ FIAKD SNE ++EI+ +LEGLL LMR+EGY L +E D E Sbjct: 620 IETSGRLQSFIAKDMSNEMSDEIYALLEGLLGLMREEGYVLQEELDYE 667 >XP_004497436.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Cicer arietinum] Length = 677 Score = 63.5 bits (153), Expect = 3e-09 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEE 144 IE GRLQ FIAKD SNE ++EI+ +LEGLL LMR+EGY L +E D E Sbjct: 629 IETSGRLQSFIAKDMSNEMSDEIYALLEGLLGLMREEGYVLQEELDYE 676 >XP_007208103.1 hypothetical protein PRUPE_ppa001024mg [Prunus persica] Length = 931 Score = 62.8 bits (151), Expect = 7e-09 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEES 147 IE LQ FIAKD SN RTEEI+ ILEGLL LM+++GY L DE DEE+ Sbjct: 616 IETSDGLQSFIAKDVSNGRTEEIYEILEGLLGLMKEKGYVLQDELDEET 664 >XP_015899544.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Ziziphus jujuba] XP_015899573.1 PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Ziziphus jujuba] Length = 667 Score = 62.4 bits (150), Expect = 9e-09 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEESVGS 156 IE +Q FIA+D SN RTEEI+ IL+GLL LM++EGY L DE DEESV S Sbjct: 616 IETSCGVQSFIARDVSNGRTEEIYDILKGLLGLMKEEGYILQDELDEESVYS 667 >GAU38027.1 hypothetical protein TSUD_395870 [Trifolium subterraneum] Length = 668 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEE 144 IE +GRL+ FIAKD SNE ++EI+ +L+GLL LMR+EGY L +E D E Sbjct: 620 IETNGRLREFIAKDMSNEMSDEIYALLDGLLGLMREEGYILQEELDFE 667 >KDO47493.1 hypothetical protein CISIN_1g012234mg [Citrus sinensis] Length = 468 Score = 61.2 bits (147), Expect = 2e-08 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEES 147 IE G LQ F+AKD S +++E+I++ILE LL LMR+EGY L+DE +EES Sbjct: 417 IECSGGLQSFVAKDTSGDKSEQIYLILERLLGLMREEGYVLLDEVEEES 465 >XP_015949274.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g37310 [Arachis duranensis] Length = 620 Score = 61.2 bits (147), Expect = 2e-08 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = +1 Query: 1 IEAHGRLQRFIAKDASNERTEEIHVILEGLLELMRDEGYDLMDEFDEE 144 IE L FIAKD SNER++EI+ +LEGLL LMRDEGY L DE D E Sbjct: 566 IETSRGLISFIAKDVSNERSDEIYALLEGLLGLMRDEGYALRDELDSE 613