BLASTX nr result
ID: Panax25_contig00044484
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00044484 (476 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM92259.1 hypothetical protein DCAR_020376 [Daucus carota subsp... 56 4e-07 >KZM92259.1 hypothetical protein DCAR_020376 [Daucus carota subsp. sativus] Length = 125 Score = 55.8 bits (133), Expect = 4e-07 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = -3 Query: 168 EENYEFNWSTSLIPLPLYHITDSIKKQLPVMEY 70 +ENYEF+WSTSLIP PL H T IKKQLPV EY Sbjct: 22 QENYEFDWSTSLIPRPLSHTTAKIKKQLPVTEY 54