BLASTX nr result
ID: Panax25_contig00044444
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00044444 (513 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB32607.1 hypothetical protein B456_005G248600 [Gossypium raimo... 73 5e-12 XP_015932360.1 PREDICTED: epimerase family protein SDR39U1 homol... 68 5e-12 XP_011092856.1 PREDICTED: epimerase family protein SDR39U1 homol... 70 4e-11 XP_016186927.1 PREDICTED: epimerase family protein SDR39U1 homol... 70 6e-11 XP_015951950.1 PREDICTED: epimerase family protein SDR39U1 homol... 70 6e-11 KYP68280.1 Epimerase family protein slr1223 family [Cajanus cajan] 69 6e-11 XP_014524306.1 PREDICTED: epimerase family protein SDR39U1 homol... 69 6e-11 KOM50951.1 hypothetical protein LR48_Vigan08g177800 [Vigna angul... 69 6e-11 WP_073640511.1 TIGR01777 family protein [Nostoc calcicola] OKH38... 69 6e-11 XP_018733383.1 PREDICTED: epimerase family protein SDR39U1 homol... 69 6e-11 CDO96985.1 unnamed protein product [Coffea canephora] 69 7e-11 XP_017431675.1 PREDICTED: epimerase family protein SDR39U1 homol... 69 8e-11 XP_014524305.1 PREDICTED: epimerase family protein SDR39U1 homol... 69 8e-11 XP_007131747.1 hypothetical protein PHAVU_011G038600g [Phaseolus... 69 8e-11 XP_010066224.1 PREDICTED: epimerase family protein SDR39U1 homol... 69 8e-11 KZN11030.1 hypothetical protein DCAR_003686 [Daucus carota subsp... 69 9e-11 XP_018733382.1 PREDICTED: epimerase family protein SDR39U1 homol... 69 1e-10 OIW08740.1 hypothetical protein TanjilG_03416 [Lupinus angustifo... 69 1e-10 XP_010066222.1 PREDICTED: epimerase family protein SDR39U1 homol... 69 1e-10 EYU40396.1 hypothetical protein MIMGU_mgv1a009159mg [Erythranthe... 69 1e-10 >KJB32607.1 hypothetical protein B456_005G248600 [Gossypium raimondii] Length = 353 Score = 72.8 bits (177), Expect = 5e-12 Identities = 29/37 (78%), Positives = 36/37 (97%) Frame = -3 Query: 112 WTFAAKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 +TFAAKM+P+F +FAGGPLGSG+QWFSWIH+DD+VNL Sbjct: 226 FTFAAKMIPLFMMFAGGPLGSGQQWFSWIHLDDIVNL 262 >XP_015932360.1 PREDICTED: epimerase family protein SDR39U1 homolog, chloroplastic-like isoform X3 [Arachis duranensis] Length = 81 Score = 67.8 bits (164), Expect = 5e-12 Identities = 26/35 (74%), Positives = 33/35 (94%) Frame = -3 Query: 106 FAAKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 F AKM+P+FK+FAGGP+G GKQWFSWIH+D++VNL Sbjct: 3 FGAKMIPLFKMFAGGPIGFGKQWFSWIHLDNIVNL 37 >XP_011092856.1 PREDICTED: epimerase family protein SDR39U1 homolog, chloroplastic-like [Sesamum indicum] Length = 363 Score = 70.1 bits (170), Expect = 4e-11 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKM+P+FK+FAGGPLGSG QWFSWIHVDDLVNL Sbjct: 235 AKMIPLFKMFAGGPLGSGTQWFSWIHVDDLVNL 267 >XP_016186927.1 PREDICTED: epimerase family protein SDR39U1 homolog, chloroplastic [Arachis ipaensis] Length = 359 Score = 69.7 bits (169), Expect = 6e-11 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKM+P+FK+FAGGP+GSGKQWFSWIH+DD+VNL Sbjct: 236 AKMIPLFKMFAGGPIGSGKQWFSWIHLDDIVNL 268 >XP_015951950.1 PREDICTED: epimerase family protein SDR39U1 homolog, chloroplastic [Arachis duranensis] Length = 359 Score = 69.7 bits (169), Expect = 6e-11 Identities = 27/33 (81%), Positives = 33/33 (100%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKM+P+FK+FAGGP+GSGKQWFSWIH+DD+VNL Sbjct: 236 AKMIPLFKMFAGGPIGSGKQWFSWIHLDDIVNL 268 >KYP68280.1 Epimerase family protein slr1223 family [Cajanus cajan] Length = 302 Score = 69.3 bits (168), Expect = 6e-11 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKM+P+F LFAGGPLGSGKQWFSWIH+DD+VNL Sbjct: 179 AKMIPLFNLFAGGPLGSGKQWFSWIHLDDIVNL 211 >XP_014524306.1 PREDICTED: epimerase family protein SDR39U1 homolog, chloroplastic isoform X2 [Vigna radiata var. radiata] Length = 302 Score = 69.3 bits (168), Expect = 6e-11 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKM+P+F LFAGGPLGSGKQWFSWIH+DD+VNL Sbjct: 179 AKMIPLFNLFAGGPLGSGKQWFSWIHLDDIVNL 211 >KOM50951.1 hypothetical protein LR48_Vigan08g177800 [Vigna angularis] Length = 302 Score = 69.3 bits (168), Expect = 6e-11 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKM+P+F LFAGGPLGSGKQWFSWIH+DD+VNL Sbjct: 179 AKMIPLFNLFAGGPLGSGKQWFSWIHLDDIVNL 211 >WP_073640511.1 TIGR01777 family protein [Nostoc calcicola] OKH38198.1 TIGR01777 family protein [Nostoc calcicola FACHB-389] Length = 306 Score = 69.3 bits (168), Expect = 6e-11 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKM+P FKLFAGGP+GSG+QWFSWIHVDDLVNL Sbjct: 183 AKMIPPFKLFAGGPIGSGRQWFSWIHVDDLVNL 215 >XP_018733383.1 PREDICTED: epimerase family protein SDR39U1 homolog, chloroplastic isoform X4 [Eucalyptus grandis] Length = 271 Score = 68.9 bits (167), Expect = 6e-11 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKMVP+F +FAGGPLGSG+QWFSWIHVDDLVNL Sbjct: 225 AKMVPLFMMFAGGPLGSGQQWFSWIHVDDLVNL 257 >CDO96985.1 unnamed protein product [Coffea canephora] Length = 288 Score = 68.9 bits (167), Expect = 7e-11 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKM+P+F +FAGGPLGSG+QWFSWIHVDDLVNL Sbjct: 236 AKMIPLFMMFAGGPLGSGRQWFSWIHVDDLVNL 268 >XP_017431675.1 PREDICTED: epimerase family protein SDR39U1 homolog, chloroplastic [Vigna angularis] BAT90994.1 hypothetical protein VIGAN_06229400 [Vigna angularis var. angularis] Length = 349 Score = 69.3 bits (168), Expect = 8e-11 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKM+P+F LFAGGPLGSGKQWFSWIH+DD+VNL Sbjct: 226 AKMIPLFNLFAGGPLGSGKQWFSWIHLDDIVNL 258 >XP_014524305.1 PREDICTED: epimerase family protein SDR39U1 homolog, chloroplastic isoform X1 [Vigna radiata var. radiata] Length = 349 Score = 69.3 bits (168), Expect = 8e-11 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKM+P+F LFAGGPLGSGKQWFSWIH+DD+VNL Sbjct: 226 AKMIPLFNLFAGGPLGSGKQWFSWIHLDDIVNL 258 >XP_007131747.1 hypothetical protein PHAVU_011G038600g [Phaseolus vulgaris] ESW03741.1 hypothetical protein PHAVU_011G038600g [Phaseolus vulgaris] Length = 349 Score = 69.3 bits (168), Expect = 8e-11 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKM+P+F LFAGGPLGSGKQWFSWIH+DD+VNL Sbjct: 226 AKMIPLFNLFAGGPLGSGKQWFSWIHLDDIVNL 258 >XP_010066224.1 PREDICTED: epimerase family protein SDR39U1 homolog, chloroplastic isoform X3 [Eucalyptus grandis] Length = 302 Score = 68.9 bits (167), Expect = 8e-11 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKMVP+F +FAGGPLGSG+QWFSWIHVDDLVNL Sbjct: 179 AKMVPLFMMFAGGPLGSGQQWFSWIHVDDLVNL 211 >KZN11030.1 hypothetical protein DCAR_003686 [Daucus carota subsp. sativus] Length = 317 Score = 68.9 bits (167), Expect = 9e-11 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKM+PIF +FAGGPLGSGKQWFSWIHVDDLV+L Sbjct: 194 AKMIPIFMMFAGGPLGSGKQWFSWIHVDDLVSL 226 >XP_018733382.1 PREDICTED: epimerase family protein SDR39U1 homolog, chloroplastic isoform X2 [Eucalyptus grandis] Length = 330 Score = 68.9 bits (167), Expect = 1e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKMVP+F +FAGGPLGSG+QWFSWIHVDDLVNL Sbjct: 207 AKMVPLFMMFAGGPLGSGQQWFSWIHVDDLVNL 239 >OIW08740.1 hypothetical protein TanjilG_03416 [Lupinus angustifolius] Length = 289 Score = 68.6 bits (166), Expect = 1e-10 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKMVP+F +FAGGPLGSGKQWFSWIH+DD+VNL Sbjct: 166 AKMVPLFMMFAGGPLGSGKQWFSWIHLDDIVNL 198 >XP_010066222.1 PREDICTED: epimerase family protein SDR39U1 homolog, chloroplastic isoform X1 [Eucalyptus grandis] KCW64071.1 hypothetical protein EUGRSUZ_G01732 [Eucalyptus grandis] Length = 348 Score = 68.9 bits (167), Expect = 1e-10 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKMVP+F +FAGGPLGSG+QWFSWIHVDDLVNL Sbjct: 225 AKMVPLFMMFAGGPLGSGQQWFSWIHVDDLVNL 257 >EYU40396.1 hypothetical protein MIMGU_mgv1a009159mg [Erythranthe guttata] Length = 349 Score = 68.9 bits (167), Expect = 1e-10 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -3 Query: 100 AKMVPIFKLFAGGPLGSGKQWFSWIHVDDLVNL 2 AKM+P+F +FAGGPLG+GKQWFSWIHVDDLVNL Sbjct: 226 AKMIPLFMMFAGGPLGTGKQWFSWIHVDDLVNL 258