BLASTX nr result
ID: Panax25_contig00044395
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00044395 (877 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013442820.1 ribosomal protein S12C [Medicago truncatula] KEH1... 75 1e-11 >XP_013442820.1 ribosomal protein S12C [Medicago truncatula] KEH16845.1 ribosomal protein S12C [Medicago truncatula] Length = 362 Score = 74.7 bits (182), Expect = 1e-11 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 263 MRSNGLTGQAVVLKGNLAREIQQTRDRDKASLSSKWSQAN 144 MRSN LTGQAVVLKGNLAR+I+QTRDRDKASLSSKWSQAN Sbjct: 1 MRSNRLTGQAVVLKGNLARKIKQTRDRDKASLSSKWSQAN 40