BLASTX nr result
ID: Panax25_contig00044265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00044265 (455 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009357092.1 PREDICTED: protein ULTRAPETALA 1-like [Pyrus x br... 55 4e-06 XP_009350712.1 PREDICTED: protein ULTRAPETALA 1-like [Pyrus x br... 55 4e-06 XP_008341916.1 PREDICTED: protein ULTRAPETALA 1 [Malus domestica] 55 4e-06 XP_008372081.1 PREDICTED: protein ULTRAPETALA 1-like [Malus dome... 55 4e-06 XP_010095817.1 hypothetical protein L484_022173 [Morus notabilis... 55 4e-06 XP_004304116.1 PREDICTED: protein ULTRAPETALA 1 [Fragaria vesca ... 54 6e-06 >XP_009357092.1 PREDICTED: protein ULTRAPETALA 1-like [Pyrus x bretschneideri] Length = 236 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +1 Query: 1 AVGTLRVFLNGDLEISCECTPGCKEGAL 84 AVG LRVF+NGDLEI+CECTPGC+EG L Sbjct: 46 AVGRLRVFVNGDLEITCECTPGCQEGKL 73 >XP_009350712.1 PREDICTED: protein ULTRAPETALA 1-like [Pyrus x bretschneideri] Length = 236 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +1 Query: 1 AVGTLRVFLNGDLEISCECTPGCKEGAL 84 AVG LRVF+NGDLEI+CECTPGC+EG L Sbjct: 46 AVGRLRVFVNGDLEITCECTPGCQEGKL 73 >XP_008341916.1 PREDICTED: protein ULTRAPETALA 1 [Malus domestica] Length = 236 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +1 Query: 1 AVGTLRVFLNGDLEISCECTPGCKEGAL 84 AVG LRVF+NGDLEI+CECTPGC+EG L Sbjct: 46 AVGRLRVFVNGDLEITCECTPGCQEGKL 73 >XP_008372081.1 PREDICTED: protein ULTRAPETALA 1-like [Malus domestica] XP_008356130.1 PREDICTED: protein ULTRAPETALA 1-like [Malus domestica] Length = 236 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +1 Query: 1 AVGTLRVFLNGDLEISCECTPGCKEGAL 84 AVG LRVF+NGDLEI+CECTPGC+EG L Sbjct: 46 AVGRLRVFVNGDLEITCECTPGCQEGKL 73 >XP_010095817.1 hypothetical protein L484_022173 [Morus notabilis] EXB62285.1 hypothetical protein L484_022173 [Morus notabilis] Length = 237 Score = 54.7 bits (130), Expect = 4e-06 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = +1 Query: 1 AVGTLRVFLNGDLEISCECTPGCKEGAL 84 AVG LRVFLNGDL+I+CECTPGC+EG L Sbjct: 47 AVGRLRVFLNGDLQITCECTPGCQEGKL 74 >XP_004304116.1 PREDICTED: protein ULTRAPETALA 1 [Fragaria vesca subsp. vesca] Length = 229 Score = 54.3 bits (129), Expect = 6e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 1 AVGTLRVFLNGDLEISCECTPGCKEGALFILIF 99 AVG LRVF+NG+LEI+CECTPGC+EG L +F Sbjct: 39 AVGRLRVFMNGELEITCECTPGCQEGTLSPSLF 71