BLASTX nr result
ID: Panax25_contig00044258
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00044258 (398 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ALD47591.1 BTB/POZ and TAZ domain-containing protein [Lonicera j... 92 2e-19 XP_019266630.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 87 2e-17 XP_016479665.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 87 2e-17 XP_009604071.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 87 2e-17 XP_009759977.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 86 3e-17 OIT37799.1 btbpoz and taz domain-containing protein 4 [Nicotiana... 84 3e-17 XP_015578516.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 84 4e-17 XP_019195495.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 85 6e-17 XP_009587549.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 85 8e-17 OAY33639.1 hypothetical protein MANES_13G112500 [Manihot esculenta] 85 9e-17 XP_016560955.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 85 9e-17 EEF37093.1 transcription cofactor, putative [Ricinus communis] 84 1e-16 XP_017238082.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 84 2e-16 XP_016441815.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 84 2e-16 XP_009787049.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 84 2e-16 XP_018854544.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 80 2e-16 XP_016480334.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 83 4e-16 XP_003632492.1 PREDICTED: BTB/POZ and TAZ domain-containing prot... 82 1e-15 CDP02595.1 unnamed protein product [Coffea canephora] 82 1e-15 KVH92476.1 BTB/POZ-like protein [Cynara cardunculus var. scolymus] 82 1e-15 >ALD47591.1 BTB/POZ and TAZ domain-containing protein [Lonicera japonica] Length = 371 Score = 91.7 bits (226), Expect = 2e-19 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAS 245 DSD+CRVPLCRN K + +KQNKKD++KWRILVRKILRTKSISGAPFF+LAS Sbjct: 320 DSDMCRVPLCRNFKQKRRKQNKKDEMKWRILVRKILRTKSISGAPFFSLAS 370 >XP_019266630.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Nicotiana attenuata] OIT34921.1 btbpoz and taz domain-containing protein 4 [Nicotiana attenuata] Length = 379 Score = 86.7 bits (213), Expect = 2e-17 Identities = 39/52 (75%), Positives = 47/52 (90%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAST 242 +SDVCRVPLCRN K + +KQNKKD++KWRILVRKI+R+KSISGAPFF+ ST Sbjct: 328 NSDVCRVPLCRNFKQKRRKQNKKDEMKWRILVRKIVRSKSISGAPFFSFEST 379 >XP_016479665.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] Length = 380 Score = 86.7 bits (213), Expect = 2e-17 Identities = 39/52 (75%), Positives = 47/52 (90%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAST 242 +SDVCRVPLCRN K + +KQNKKD++KWRILVRKI+R+KSISGAPFF+ ST Sbjct: 329 NSDVCRVPLCRNFKQKRRKQNKKDEMKWRILVRKIVRSKSISGAPFFSFEST 380 >XP_009604071.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tomentosiformis] XP_009604072.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tomentosiformis] XP_018627202.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tomentosiformis] Length = 380 Score = 86.7 bits (213), Expect = 2e-17 Identities = 39/52 (75%), Positives = 47/52 (90%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAST 242 +SDVCRVPLCRN K + +KQNKKD++KWRILVRKI+R+KSISGAPFF+ ST Sbjct: 329 NSDVCRVPLCRNFKQKRRKQNKKDEMKWRILVRKIVRSKSISGAPFFSFEST 380 >XP_009759977.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] XP_009759978.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] XP_009759979.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] XP_016434919.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] XP_016434920.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] XP_016434921.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] XP_016434922.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] XP_016434923.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] XP_016434924.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] Length = 379 Score = 85.9 bits (211), Expect = 3e-17 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAST 242 +SDVCRVPLCRN K + +KQNKKD++KWRILVRKI R+KSISGAPFF+ ST Sbjct: 328 NSDVCRVPLCRNFKQKRRKQNKKDEMKWRILVRKIARSKSISGAPFFSFEST 379 >OIT37799.1 btbpoz and taz domain-containing protein 4 [Nicotiana attenuata] Length = 241 Score = 84.0 bits (206), Expect = 3e-17 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTL 251 DSDVCRVPLCRN K R ++Q KKD+IKWRILVRKI+R+KSISG PFF+L Sbjct: 190 DSDVCRVPLCRNFKQRRRRQKKKDEIKWRILVRKIVRSKSISGMPFFSL 238 >XP_015578516.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Ricinus communis] Length = 246 Score = 84.0 bits (206), Expect = 4e-17 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLA 248 DSD CRVPLC+N K RIK+Q+KKD+IKWRILV+KI+RTK I G+PFFT A Sbjct: 192 DSDACRVPLCKNFKARIKRQSKKDEIKWRILVKKIIRTKRIGGSPFFTSA 241 >XP_019195495.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like isoform X1 [Ipomoea nil] Length = 373 Score = 85.1 bits (209), Expect = 6e-17 Identities = 37/52 (71%), Positives = 48/52 (92%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAST 242 DSD C+VPLCRN K +++KQNKKD++KW+ILVRKI+R+KSISGAPFF++ ST Sbjct: 322 DSDNCKVPLCRNFKEKMRKQNKKDEMKWKILVRKIVRSKSISGAPFFSVEST 373 >XP_009587549.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tomentosiformis] XP_009587550.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tomentosiformis] Length = 370 Score = 84.7 bits (208), Expect = 8e-17 Identities = 38/52 (73%), Positives = 46/52 (88%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAST 242 DSDVCRVPLCRN K R ++Q KKD+IKWRILV+KI+R+KSISG PFF+L S+ Sbjct: 319 DSDVCRVPLCRNFKQRRRRQKKKDEIKWRILVKKIVRSKSISGMPFFSLGSS 370 >OAY33639.1 hypothetical protein MANES_13G112500 [Manihot esculenta] Length = 378 Score = 84.7 bits (208), Expect = 9e-17 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLA 248 DS++CRVPLCRN K RI+KQNKKD++KWRILV+KILRTK I +PFF+LA Sbjct: 324 DSNLCRVPLCRNFKVRIRKQNKKDEVKWRILVKKILRTKRIGSSPFFSLA 373 >XP_016560955.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Capsicum annuum] XP_016560956.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Capsicum annuum] Length = 379 Score = 84.7 bits (208), Expect = 9e-17 Identities = 38/50 (76%), Positives = 45/50 (90%) Frame = -2 Query: 391 DVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAST 242 DVCRVPLCRN K + +KQNKKD++KWRILVRKI+R+KSISGAPFF+ ST Sbjct: 330 DVCRVPLCRNFKQKRRKQNKKDEMKWRILVRKIVRSKSISGAPFFSFEST 379 >EEF37093.1 transcription cofactor, putative [Ricinus communis] Length = 347 Score = 84.0 bits (206), Expect = 1e-16 Identities = 37/50 (74%), Positives = 44/50 (88%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLA 248 DSD CRVPLC+N K RIK+Q+KKD+IKWRILV+KI+RTK I G+PFFT A Sbjct: 293 DSDACRVPLCKNFKARIKRQSKKDEIKWRILVKKIIRTKRIGGSPFFTSA 342 >XP_017238082.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Daucus carota subsp. sativus] Length = 373 Score = 84.0 bits (206), Expect = 2e-16 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAST 242 DSD+C+VPLCR LKYR +KK+D+KWRILVRKI RTKSISGAPFF+ A+T Sbjct: 319 DSDMCKVPLCRTLKYRTTNVSKKEDMKWRILVRKISRTKSISGAPFFSFATT 370 >XP_016441815.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] XP_016441821.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana tabacum] Length = 371 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAST 242 DSD CRVPLCRN K R ++Q KKD+IKWRILVRKI+R+KSISG PFF+L S+ Sbjct: 320 DSDFCRVPLCRNFKQRRRRQKKKDEIKWRILVRKIVRSKSISGMPFFSLESS 371 >XP_009787049.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] XP_009787050.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Nicotiana sylvestris] Length = 371 Score = 83.6 bits (205), Expect = 2e-16 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAST 242 DSD CRVPLCRN K R ++Q KKD+IKWRILVRKI+R+KSISG PFF+L S+ Sbjct: 320 DSDFCRVPLCRNFKQRRRRQKKKDEIKWRILVRKIVRSKSISGMPFFSLESS 371 >XP_018854544.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like [Juglans regia] Length = 149 Score = 79.7 bits (195), Expect = 2e-16 Identities = 36/48 (75%), Positives = 43/48 (89%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFT 254 +SDVCRVPLCRN K RI++Q+KKD+IKWRILV+KILRT I GAPFF+ Sbjct: 95 NSDVCRVPLCRNFKERIRRQSKKDEIKWRILVKKILRTVPIVGAPFFS 142 >XP_016480334.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like isoform X1 [Nicotiana tabacum] XP_016480335.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4-like isoform X1 [Nicotiana tabacum] Length = 370 Score = 82.8 bits (203), Expect = 4e-16 Identities = 38/52 (73%), Positives = 45/52 (86%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAST 242 DSDVCRVPLCRN K R ++Q KKD+IKWRILVRKI+R+KSISG FF+L S+ Sbjct: 319 DSDVCRVPLCRNFKQRRRRQKKKDEIKWRILVRKIVRSKSISGITFFSLGSS 370 >XP_003632492.1 PREDICTED: BTB/POZ and TAZ domain-containing protein 4 [Vitis vinifera] CBI33698.3 unnamed protein product, partial [Vitis vinifera] Length = 371 Score = 81.6 bits (200), Expect = 1e-15 Identities = 37/47 (78%), Positives = 41/47 (87%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFF 257 DSD+CRVPLCRN K RIKKQ+KKD++KWRILVRKILR K I APFF Sbjct: 325 DSDICRVPLCRNFKDRIKKQSKKDEMKWRILVRKILRAKGIGKAPFF 371 >CDP02595.1 unnamed protein product [Coffea canephora] Length = 378 Score = 81.6 bits (200), Expect = 1e-15 Identities = 34/50 (68%), Positives = 47/50 (94%) Frame = -2 Query: 391 DVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAST 242 ++CRVPLCRN K++ +++NKKD++KWRILVRKI+R+KSISGAPFF+L S+ Sbjct: 329 NICRVPLCRNFKHKRRRENKKDELKWRILVRKIVRSKSISGAPFFSLESS 378 >KVH92476.1 BTB/POZ-like protein [Cynara cardunculus var. scolymus] Length = 388 Score = 81.6 bits (200), Expect = 1e-15 Identities = 35/52 (67%), Positives = 47/52 (90%) Frame = -2 Query: 397 DSDVCRVPLCRNLKYRIKKQNKKDDIKWRILVRKILRTKSISGAPFFTLAST 242 DS+ C+VPLC+NLK + KKQ KKDDI W+ILV+KILR+KSI+GAP+F+L++T Sbjct: 336 DSNTCKVPLCKNLKEKTKKQKKKDDIMWKILVKKILRSKSITGAPYFSLSAT 387