BLASTX nr result
ID: Panax25_contig00044038
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00044038 (503 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM87636.1 hypothetical protein DCAR_031924 [Daucus carota subsp... 63 1e-08 KZM94204.1 hypothetical protein DCAR_017447 [Daucus carota subsp... 63 1e-08 >KZM87636.1 hypothetical protein DCAR_031924 [Daucus carota subsp. sativus] Length = 338 Score = 63.2 bits (152), Expect = 1e-08 Identities = 32/82 (39%), Positives = 46/82 (56%) Frame = -3 Query: 483 LKGKTVDVGQVIHDFIRHAI*GGSTQGLPHPYLICGL*KWVKVTWDEDEML*PP*AVIDH 304 + GK +D+G VIH I + GG+T +P+ ++ L + V W +E L P A IDH Sbjct: 154 VSGKYIDLGHVIHQGILRFLQGGTTGAIPYGTIVTKLCRSSGVRWPANEQLQLPAAPIDH 213 Query: 303 DTISRHKVWEGKIYHPRGASFI 238 ISR W+G + HPRG +I Sbjct: 214 SAISRMTEWDGGVPHPRGLGYI 235 >KZM94204.1 hypothetical protein DCAR_017447 [Daucus carota subsp. sativus] Length = 402 Score = 63.2 bits (152), Expect = 1e-08 Identities = 32/82 (39%), Positives = 46/82 (56%) Frame = -3 Query: 483 LKGKTVDVGQVIHDFIRHAI*GGSTQGLPHPYLICGL*KWVKVTWDEDEML*PP*AVIDH 304 + GK +D+G VIH I + GG+T +P+ ++ L + V W +E L P A IDH Sbjct: 218 VSGKYIDLGHVIHQGILRFLQGGTTGAIPYGTIVTKLCRASGVRWPANEQLQLPAAPIDH 277 Query: 303 DTISRHKVWEGKIYHPRGASFI 238 ISR W+G + HPRG +I Sbjct: 278 SAISRMTEWDGGVPHPRGLGYI 299