BLASTX nr result
ID: Panax25_contig00043635
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00043635 (439 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019174161.1 PREDICTED: CAP-Gly domain-containing linker prote... 54 8e-06 >XP_019174161.1 PREDICTED: CAP-Gly domain-containing linker protein 1 isoform X1 [Ipomoea nil] Length = 354 Score = 54.3 bits (129), Expect = 8e-06 Identities = 24/40 (60%), Positives = 33/40 (82%) Frame = -2 Query: 435 SQVVEKGSGNSKRKTVASTSVAETPKLFSSRFKVPKLKSS 316 S +EKG GNSKRK +A ++++TPKLF+S FK+PKLK+S Sbjct: 307 SPALEKGRGNSKRKQLAVITISDTPKLFTSSFKIPKLKNS 346