BLASTX nr result
ID: Panax25_contig00043557
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00043557 (533 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_002517698.1 PREDICTED: homoserine kinase [Ricinus communis] E... 40 4e-06 XP_015159391.1 PREDICTED: homoserine kinase-like [Solanum tubero... 45 4e-06 XP_015062516.1 PREDICTED: homoserine kinase-like [Solanum pennel... 45 4e-06 >XP_002517698.1 PREDICTED: homoserine kinase [Ricinus communis] EEF44862.1 homoserine kinase, putative [Ricinus communis] Length = 367 Score = 40.0 bits (92), Expect(2) = 4e-06 Identities = 23/43 (53%), Positives = 25/43 (58%) Frame = -3 Query: 276 CAVDYLDDFVTPPVDAHVHPSPSEISIFEINSRQFFKKAQQRP 148 CAVD L DFVT VD VH P EISI EI+ KK + P Sbjct: 68 CAVDGLGDFVTVTVDPSVH--PGEISIAEISGTHASKKLSKNP 108 Score = 37.7 bits (86), Expect(2) = 4e-06 Identities = 18/27 (66%), Positives = 23/27 (85%) Frame = -1 Query: 140 NRAGIAVISIMRMLNIRSVGMSLSLHK 60 N AGIA I+ M+MLN+RSVG+SL+L K Sbjct: 111 NCAGIAGIATMKMLNVRSVGLSLTLEK 137 >XP_015159391.1 PREDICTED: homoserine kinase-like [Solanum tuberosum] Length = 365 Score = 45.1 bits (105), Expect(2) = 4e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = -1 Query: 140 NRAGIAVISIMRMLNIRSVGMSLSLHK 60 N AGIA IS+M+MLNIRSVG++LSLHK Sbjct: 110 NCAGIAAISVMKMLNIRSVGLTLSLHK 136 Score = 32.7 bits (73), Expect(2) = 4e-06 Identities = 19/43 (44%), Positives = 27/43 (62%) Frame = -3 Query: 276 CAVDYLDDFVTPPVDAHVHPSPSEISIFEINSRQFFKKAQQRP 148 CAVD + DFVT +D +VH P E+SI +I+ KK ++ P Sbjct: 69 CAVDGIGDFVTLRLDPNVH--PGEVSISDISGAG--KKLRRNP 107 >XP_015062516.1 PREDICTED: homoserine kinase-like [Solanum pennellii] Length = 357 Score = 45.1 bits (105), Expect(2) = 4e-06 Identities = 21/27 (77%), Positives = 25/27 (92%) Frame = -1 Query: 140 NRAGIAVISIMRMLNIRSVGMSLSLHK 60 N AGIA IS+M+MLNIRSVG++LSLHK Sbjct: 102 NCAGIAAISVMKMLNIRSVGLTLSLHK 128 Score = 32.7 bits (73), Expect(2) = 4e-06 Identities = 19/43 (44%), Positives = 27/43 (62%) Frame = -3 Query: 276 CAVDYLDDFVTPPVDAHVHPSPSEISIFEINSRQFFKKAQQRP 148 CAVD + DFVT +D +VH P E+SI +I+ KK ++ P Sbjct: 61 CAVDGIGDFVTLRLDPNVH--PGEVSISDISGAG--KKLRRNP 99