BLASTX nr result
ID: Panax25_contig00043546
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00043546 (432 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_001934086.1 ADP/ATP carrier protein [Pyrenophora tritici-repe... 62 2e-08 XP_013431897.1 mitochondrial carrier [Aureobasidium namibiae CBS... 62 2e-08 XP_018379648.1 ADP,ATP carrier protein-like protein [Alternaria ... 62 2e-08 XP_013342352.1 hypothetical protein AUEXF2481DRAFT_47440 [Aureob... 62 2e-08 XP_003840256.1 similar to ADP,ATP carrier protein [Leptosphaeria... 62 2e-08 OJJ86398.1 hypothetical protein ASPGLDRAFT_44191 [Aspergillus gl... 62 2e-08 XP_003304315.1 ADP/ATP carrier protein [Pyrenophora teres f. ter... 62 2e-08 EYE94375.1 putative mitochondrial ADP,ATP carrier protein, parti... 61 3e-08 XP_018032087.1 mitochondrial carrier [Paraphaeosphaeria sporulos... 61 3e-08 XP_001796004.1 hypothetical protein SNOG_05601 [Parastagonospora... 61 3e-08 ODM23861.1 ADP,ATP carrier protein [Aspergillus cristatus] 61 3e-08 OJJ04101.1 hypothetical protein ASPVEDRAFT_43557 [Aspergillus ve... 60 5e-08 XP_015400768.1 ADP/ATP carrier protein [Aspergillus nomius NRRL ... 60 5e-08 OJJ70582.1 hypothetical protein ASPBRDRAFT_44794 [Aspergillus br... 60 5e-08 KIM93068.1 hypothetical protein OIDMADRAFT_92321, partial [Oidio... 56 5e-08 CDO56257.1 similar to Saccharomyces cerevisiae YBL030C PET9 Majo... 55 6e-08 OMP87056.1 ADP,ATP carrier protein [Diplodia seriata] 60 6e-08 XP_750288.1 mitochondrial ADP,ATP carrier protein (Ant) [Aspergi... 60 6e-08 OKO93697.1 ADP,ATP carrier protein [Penicillium subrubescens] 60 6e-08 OJJ60163.1 hypothetical protein ASPSYDRAFT_57616 [Aspergillus sy... 60 6e-08 >XP_001934086.1 ADP/ATP carrier protein [Pyrenophora tritici-repentis Pt-1C-BFP] EDU46591.1 ADP,ATP carrier protein [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 313 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL Sbjct: 273 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 303 >XP_013431897.1 mitochondrial carrier [Aureobasidium namibiae CBS 147.97] KEQ77702.1 mitochondrial carrier [Aureobasidium namibiae CBS 147.97] Length = 315 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL Sbjct: 275 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 305 >XP_018379648.1 ADP,ATP carrier protein-like protein [Alternaria alternata] OAG14227.1 ADP,ATP carrier protein-like protein [Alternaria alternata] Length = 316 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL Sbjct: 276 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 306 >XP_013342352.1 hypothetical protein AUEXF2481DRAFT_47440 [Aureobasidium subglaciale EXF-2481] KEQ93767.1 hypothetical protein AUEXF2481DRAFT_47440 [Aureobasidium subglaciale EXF-2481] Length = 316 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL Sbjct: 276 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 306 >XP_003840256.1 similar to ADP,ATP carrier protein [Leptosphaeria maculans JN3] CBX96777.1 similar to ADP,ATP carrier protein [Leptosphaeria maculans JN3] Length = 316 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL Sbjct: 276 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 306 >OJJ86398.1 hypothetical protein ASPGLDRAFT_44191 [Aspergillus glaucus CBS 516.65] Length = 317 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL Sbjct: 281 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 311 >XP_003304315.1 ADP/ATP carrier protein [Pyrenophora teres f. teres 0-1] EFQ87592.1 hypothetical protein PTT_16860 [Pyrenophora teres f. teres 0-1] Length = 349 Score = 61.6 bits (148), Expect = 2e-08 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL Sbjct: 309 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 339 >EYE94375.1 putative mitochondrial ADP,ATP carrier protein, partial [Aspergillus ruber CBS 135680] Length = 291 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQAQL+L Sbjct: 255 KSLFKGAGANILRGVAGAGVLSIYDQAQLLL 285 >XP_018032087.1 mitochondrial carrier [Paraphaeosphaeria sporulosa] OAG01722.1 mitochondrial carrier [Paraphaeosphaeria sporulosa] Length = 315 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQAQLI+ Sbjct: 275 KSLFKGAGANILRGVAGAGVLSIYDQAQLIM 305 >XP_001796004.1 hypothetical protein SNOG_05601 [Parastagonospora nodorum SN15] EAT86665.1 hypothetical protein SNOG_05601 [Parastagonospora nodorum SN15] Length = 315 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQAQLI+ Sbjct: 275 KSLFKGAGANILRGVAGAGVLSIYDQAQLIM 305 >ODM23861.1 ADP,ATP carrier protein [Aspergillus cristatus] Length = 317 Score = 60.8 bits (146), Expect = 3e-08 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQAQL+L Sbjct: 281 KSLFKGAGANILRGVAGAGVLSIYDQAQLLL 311 >OJJ04101.1 hypothetical protein ASPVEDRAFT_43557 [Aspergillus versicolor CBS 583.65] Length = 263 Score = 60.1 bits (144), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQ QLIL Sbjct: 227 KSLFKGAGANILRGVAGAGVLSIYDQVQLIL 257 >XP_015400768.1 ADP/ATP carrier protein [Aspergillus nomius NRRL 13137] KNG79845.1 ADP/ATP carrier protein [Aspergillus nomius NRRL 13137] Length = 263 Score = 60.1 bits (144), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQ QLIL Sbjct: 227 KSLFKGAGANILRGVAGAGVLSIYDQVQLIL 257 >OJJ70582.1 hypothetical protein ASPBRDRAFT_44794 [Aspergillus brasiliensis CBS 101740] Length = 267 Score = 60.1 bits (144), Expect = 5e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQ QLIL Sbjct: 227 KSLFKGAGANILRGVAGAGVLSIYDQVQLIL 257 >KIM93068.1 hypothetical protein OIDMADRAFT_92321, partial [Oidiodendron maius Zn] Length = 50 Score = 55.8 bits (133), Expect = 5e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 +SLFKGAGANILRGVAGAGVLSIYDQ Q+++ Sbjct: 15 RSLFKGAGANILRGVAGAGVLSIYDQLQVLM 45 >CDO56257.1 similar to Saccharomyces cerevisiae YBL030C PET9 Major ADP/ATP carrier of the mitochondrial inner membrane,partial (5' in gap) (Partial), partial [Geotrichum candidum] Length = 37 Score = 55.5 bits (132), Expect = 6e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKG GANILRGVAGAGV+S+YDQ Q+IL Sbjct: 1 KSLFKGCGANILRGVAGAGVISMYDQLQMIL 31 >OMP87056.1 ADP,ATP carrier protein [Diplodia seriata] Length = 282 Score = 60.1 bits (144), Expect = 6e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQ QLIL Sbjct: 242 KSLFKGAGANILRGVAGAGVLSIYDQVQLIL 272 >XP_750288.1 mitochondrial ADP,ATP carrier protein (Ant) [Aspergillus fumigatus Af293] EAL88250.1 mitochondrial ADP,ATP carrier protein (Ant), putative [Aspergillus fumigatus Af293] EDP55874.1 mitochondrial ADP,ATP carrier protein (Ant), putative [Aspergillus fumigatus A1163] Length = 308 Score = 60.1 bits (144), Expect = 6e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQ QLIL Sbjct: 268 KSLFKGAGANILRGVAGAGVLSIYDQVQLIL 298 >OKO93697.1 ADP,ATP carrier protein [Penicillium subrubescens] Length = 311 Score = 60.1 bits (144), Expect = 6e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQ QLIL Sbjct: 275 KSLFKGAGANILRGVAGAGVLSIYDQVQLIL 305 >OJJ60163.1 hypothetical protein ASPSYDRAFT_57616 [Aspergillus sydowii CBS 593.65] Length = 311 Score = 60.1 bits (144), Expect = 6e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -1 Query: 432 KSLFKGAGANILRGVAGAGVLSIYDQAQLIL 340 KSLFKGAGANILRGVAGAGVLSIYDQ QLIL Sbjct: 275 KSLFKGAGANILRGVAGAGVLSIYDQVQLIL 305