BLASTX nr result
ID: Panax25_contig00043505
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00043505 (450 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM86066.1 hypothetical protein DCAR_026512 [Daucus carota subsp... 69 1e-10 XP_009624960.1 PREDICTED: putative glucose-6-phosphate 1-epimera... 55 4e-06 >KZM86066.1 hypothetical protein DCAR_026512 [Daucus carota subsp. sativus] Length = 751 Score = 68.6 bits (166), Expect = 1e-10 Identities = 39/72 (54%), Positives = 47/72 (65%), Gaps = 3/72 (4%) Frame = +1 Query: 244 TIKKVDGKLEEWKKRGFKKNPIADIIRWRFFRS-LKQM--PFDFINHPFGFPRVLLSEAG 414 TI +L++ +K FK+N + D IRWR S LKQM PF FIN P P VLLSE G Sbjct: 405 TIPPAINQLDKGRKEAFKRNLVVDRIRWRILLSFLKQMEMPFRFINGPSSLPCVLLSEPG 464 Query: 415 GSSAEVLLYGGQ 450 GSSA+V L+GGQ Sbjct: 465 GSSAQVQLFGGQ 476 >XP_009624960.1 PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X1 [Nicotiana tomentosiformis] XP_016516156.1 PREDICTED: putative glucose-6-phosphate 1-epimerase isoform X1 [Nicotiana tabacum] Length = 296 Score = 55.1 bits (131), Expect = 4e-06 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +1 Query: 352 MPFDFINHPFGFPRVLLSEAGGSSAEVLLYGGQ 450 MPFD ++ GFPRVLLSE GGSSAEVLLYGGQ Sbjct: 1 MPFDVVDDSNGFPRVLLSEPGGSSAEVLLYGGQ 33