BLASTX nr result
ID: Panax25_contig00043445
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00043445 (358 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM90722.1 hypothetical protein DCAR_021913 [Daucus carota subsp... 55 1e-06 XP_017256528.1 PREDICTED: probable ubiquitin-like-specific prote... 55 2e-06 >KZM90722.1 hypothetical protein DCAR_021913 [Daucus carota subsp. sativus] Length = 371 Score = 55.5 bits (132), Expect = 1e-06 Identities = 30/55 (54%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -2 Query: 351 LPNQKANFIEITDSTEGHSPV-SVIKGRRAAKRPRAMVLEEESPLSKRPQMIMLD 190 L ++++NFIEITDS E H+ + S + R +AKRPR M+LEEE PL KR Q I++D Sbjct: 317 LSSEESNFIEITDSGERHTSLTSDAEERMSAKRPRNMLLEEEEPLRKRFQTIVID 371 >XP_017256528.1 PREDICTED: probable ubiquitin-like-specific protease 2A [Daucus carota subsp. sativus] Length = 897 Score = 55.5 bits (132), Expect = 2e-06 Identities = 30/55 (54%), Positives = 41/55 (74%), Gaps = 1/55 (1%) Frame = -2 Query: 351 LPNQKANFIEITDSTEGHSPV-SVIKGRRAAKRPRAMVLEEESPLSKRPQMIMLD 190 L ++++NFIEITDS E H+ + S + R +AKRPR M+LEEE PL KR Q I++D Sbjct: 843 LSSEESNFIEITDSGERHTSLTSDAEERMSAKRPRNMLLEEEEPLRKRFQTIVID 897