BLASTX nr result
ID: Panax25_contig00043345
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00043345 (407 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017238959.1 PREDICTED: glutamate receptor 3.2-like [Daucus ca... 54 9e-06 >XP_017238959.1 PREDICTED: glutamate receptor 3.2-like [Daucus carota subsp. sativus] KZN00540.1 hypothetical protein DCAR_009294 [Daucus carota subsp. sativus] Length = 934 Score = 53.9 bits (128), Expect = 9e-06 Identities = 29/48 (60%), Positives = 39/48 (81%), Gaps = 2/48 (4%) Frame = -2 Query: 349 LQRFLSFADEKAEVSKSKLKRKQMET-LSIGSRVEIGSR-YGSKRKQA 212 ++RFLS+ADEKA++SK+KLKRKQME+ +S R++ R YGSKR QA Sbjct: 878 IRRFLSYADEKADISKNKLKRKQMESGMSSSRRIDFTRRYYGSKRIQA 925