BLASTX nr result
ID: Panax25_contig00043250
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00043250 (606 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAP55853.1 GBR6 [Panax ginseng] 56 2e-07 >AAP55853.1 GBR6 [Panax ginseng] Length = 71 Score = 56.2 bits (134), Expect = 2e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 434 VLTSILHEISGISLIFALHPVSFHGNIDLNFLIKY 538 +LTSILHEISGISLIFALHPVSF GNI L+ L Y Sbjct: 19 ILTSILHEISGISLIFALHPVSFRGNILLSILAFY 53