BLASTX nr result
ID: Panax25_contig00043144
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00043144 (493 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016442365.1 PREDICTED: uncharacterized protein LOC107767789 [... 54 8e-07 >XP_016442365.1 PREDICTED: uncharacterized protein LOC107767789 [Nicotiana tabacum] Length = 89 Score = 54.3 bits (129), Expect = 8e-07 Identities = 28/65 (43%), Positives = 37/65 (56%) Frame = -1 Query: 391 NAVPTSGTRHLLLYETQDSTASGYTHQINTLDVVEKEELIIRGRLDLAHIDYTEAGPNTR 212 NA P S L L+E Q+ YT+Q+ L+ +E+E I GR+DL DY +G N R Sbjct: 23 NAAPISRNTRLFLHENQELPPPAYTNQMMKLEAMEEE--FINGRMDLESHDYPGSGANNR 80 Query: 211 HTPPP 197 HTP P Sbjct: 81 HTPRP 85