BLASTX nr result
ID: Panax25_contig00042819
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00042819 (524 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19190.1 hypothetical protein TSUD_198720 [Trifolium subterran... 79 2e-15 >GAU19190.1 hypothetical protein TSUD_198720 [Trifolium subterraneum] Length = 170 Score = 79.3 bits (194), Expect = 2e-15 Identities = 39/49 (79%), Positives = 41/49 (83%) Frame = +1 Query: 316 AGSSILKEKGKLPTQVQVPS*KIAVGGISSAIDEAVIGLAWLGWSHWNS 462 A + EKGKLPTQVQVPS +AVGGISSAIDEAVIGLAWLGWSH NS Sbjct: 114 ASEELAIEKGKLPTQVQVPSSNLAVGGISSAIDEAVIGLAWLGWSHRNS 162