BLASTX nr result
ID: Panax25_contig00042455
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00042455 (393 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017258795.1 PREDICTED: K(+) efflux antiporter 3, chloroplasti... 61 2e-08 >XP_017258795.1 PREDICTED: K(+) efflux antiporter 3, chloroplastic [Daucus carota subsp. sativus] KZM90747.1 hypothetical protein DCAR_021888 [Daucus carota subsp. sativus] Length = 799 Score = 61.2 bits (147), Expect = 2e-08 Identities = 31/57 (54%), Positives = 44/57 (77%) Frame = -1 Query: 288 SLSTKDASLRMNQRYGNHIQ*LPEEVDRLEYGDEFEESEDGRGVLYYELDTDNSSPI 118 S++ +D S R+NQR + +Q L +E DRLEY D+ ++SE GRGVLY ELDTD++SP+ Sbjct: 743 SVNQRDGS-RVNQRDASRVQTLAKEDDRLEYKDDSDQSEIGRGVLYCELDTDDNSPL 798