BLASTX nr result
ID: Panax25_contig00042360
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00042360 (512 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABO26299.1 polyprotein, partial [Nicotiana tabacum] 51 6e-06 >ABO26299.1 polyprotein, partial [Nicotiana tabacum] Length = 57 Score = 51.2 bits (121), Expect = 6e-06 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = +2 Query: 8 GDIAVRKVHTKENVTDMLTKSVIAEKFKHDLDLIHFVE 121 G + V+K+HT EN DMLTK VIA KF+H LDLI+ VE Sbjct: 19 GGVTVKKIHTTENPADMLTKVVIAVKFQHCLDLINIVE 56