BLASTX nr result
ID: Panax25_contig00040701
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00040701 (661 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017247944.1 PREDICTED: uncharacterized protein LOC108219160 [... 58 3e-06 >XP_017247944.1 PREDICTED: uncharacterized protein LOC108219160 [Daucus carota subsp. sativus] KZM97148.1 hypothetical protein DCAR_015490 [Daucus carota subsp. sativus] Length = 534 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/74 (41%), Positives = 44/74 (59%), Gaps = 11/74 (14%) Frame = +3 Query: 3 NEVLNSQDNEYDAMDTVTEFVEIDVQDVREDRSCHQDK-----------QEYGCVLWDLA 149 NEV + ++E+++M+TV F E ++R QDK +EYGC+LWDLA Sbjct: 96 NEVQDVCNDEHESMETVNAFGEAGGPGASDERLSEQDKHEVALVGEKAWEEYGCILWDLA 155 Query: 150 ASKTHVELMVLLLI 191 A++TH ELMV LI Sbjct: 156 ANRTHAELMVQNLI 169