BLASTX nr result
ID: Panax25_contig00040540
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00040540 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_009371707.1 PREDICTED: glucose-6-phosphate 1-dehydrogenase, c... 56 1e-07 AAB69319.1 cytosolic glucose-6-phosphate dehydrogenase 2 [Petros... 55 4e-06 OIT05956.1 glucose-6-phosphate 1-dehydrogenase, cytoplasmic isof... 50 6e-06 >XP_009371707.1 PREDICTED: glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform-like [Pyrus x bretschneideri] Length = 114 Score = 56.2 bits (134), Expect = 1e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 99 ISLIQVKKPGLEMSTVPSELDLSYGQRYQDITI 1 +S++QVK+PGLEMSTV SELDLSYGQRYQ +TI Sbjct: 1 MSVMQVKQPGLEMSTVQSELDLSYGQRYQGVTI 33 >AAB69319.1 cytosolic glucose-6-phosphate dehydrogenase 2 [Petroselinum crispum] Length = 534 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 90 IQVKKPGLEMSTVPSELDLSYGQRYQDITI 1 + VKKPGLEMST SELDLSYGQRYQD+TI Sbjct: 424 LTVKKPGLEMSTAQSELDLSYGQRYQDVTI 453 >OIT05956.1 glucose-6-phosphate 1-dehydrogenase, cytoplasmic isoform [Nicotiana attenuata] Length = 68 Score = 50.4 bits (119), Expect = 6e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 90 IQVKKPGLEMSTVPSELDLSYGQRYQDITI 1 + VKKPGL+MSTV SELDLSYGQRYQ + I Sbjct: 5 LTVKKPGLDMSTVQSELDLSYGQRYQGVVI 34