BLASTX nr result
ID: Panax25_contig00040253
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00040253 (527 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006599370.1 PREDICTED: auxilin-related protein 2-like [Glycin... 153 5e-45 KHN44933.1 Auxilin-related protein 1 [Glycine soja] 155 3e-43 CAN79639.1 hypothetical protein VITISV_014476 [Vitis vinifera] 155 4e-43 KHN11110.1 Auxilin-related protein 1 [Glycine soja] 157 1e-42 XP_019075039.1 PREDICTED: auxilin-like protein 1 isoform X3 [Vit... 161 1e-42 XP_010649121.1 PREDICTED: auxilin-like protein 1 isoform X2 [Vit... 161 1e-42 XP_002266275.1 PREDICTED: auxilin-like protein 1 isoform X1 [Vit... 161 1e-42 XP_003516401.2 PREDICTED: auxilin-like protein 1 [Glycine max] 155 4e-42 XP_019226779.1 PREDICTED: auxilin-like protein 1 [Nicotiana atte... 159 4e-42 XP_009620462.1 PREDICTED: auxilin-like protein 1 [Nicotiana tome... 159 4e-42 XP_015576256.1 PREDICTED: auxilin-like protein 1 [Ricinus communis] 159 8e-42 OMO56932.1 hypothetical protein CCACVL1_26145 [Corchorus capsula... 159 8e-42 XP_017218490.1 PREDICTED: auxilin-like protein 1 isoform X2 [Dau... 158 1e-41 XP_017218489.1 PREDICTED: auxilin-like protein 1 isoform X1 [Dau... 158 1e-41 XP_011658022.1 PREDICTED: auxilin-like protein 1 isoform X4 [Cuc... 158 1e-41 XP_016475588.1 PREDICTED: auxilin-like protein 1 [Nicotiana taba... 158 1e-41 XP_009759958.1 PREDICTED: auxilin-like protein 1 [Nicotiana sylv... 158 1e-41 XP_008440742.1 PREDICTED: auxilin-like protein 1 isoform X4 [Cuc... 158 1e-41 XP_011658021.1 PREDICTED: auxilin-like protein 1 isoform X3 [Cuc... 158 1e-41 XP_008440741.1 PREDICTED: auxilin-like protein 1 isoform X3 [Cuc... 158 1e-41 >XP_006599370.1 PREDICTED: auxilin-related protein 2-like [Glycine max] Length = 114 Score = 153 bits (386), Expect = 5e-45 Identities = 76/90 (84%), Positives = 79/90 (87%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 V+RWSSGKEGNLR LLSTL YILGP SGWQPI L DV+T AVKK YRKATL VHPDKL Sbjct: 24 VRRWSSGKEGNLRALLSTLLYILGPDSGWQPIPLTDVITSAAVKKTYRKATLCVHPDKLQ 83 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQ KYICEKVFDLLKEAWNKFNSEE Sbjct: 84 QRGASIQHKYICEKVFDLLKEAWNKFNSEE 113 >KHN44933.1 Auxilin-related protein 1 [Glycine soja] Length = 316 Score = 155 bits (391), Expect = 3e-43 Identities = 77/90 (85%), Positives = 80/90 (88%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGK GNLR LLSTLQYILGP SGWQPI L D+VT AVKKAYRKATL VHPDKL Sbjct: 226 VKRWSSGKTGNLRALLSTLQYILGPDSGWQPIPLTDIVTSTAVKKAYRKATLFVHPDKLQ 285 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKYICEKVFDLLKEAWN+FN EE Sbjct: 286 QRGASIQQKYICEKVFDLLKEAWNRFNMEE 315 >CAN79639.1 hypothetical protein VITISV_014476 [Vitis vinifera] Length = 345 Score = 155 bits (392), Expect = 4e-43 Identities = 76/90 (84%), Positives = 82/90 (91%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGKEGNLR LL+TLQYILGP SGWQPI L D++T A+KKAYRKATL VHPDKL Sbjct: 256 VKRWSSGKEGNLRALLATLQYILGPDSGWQPIPLTDIITTNAIKKAYRKATLCVHPDKLQ 315 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKYICEKVFDLL+EAWNKFNSEE Sbjct: 316 QRGASIQQKYICEKVFDLLQEAWNKFNSEE 345 >KHN11110.1 Auxilin-related protein 1 [Glycine soja] Length = 488 Score = 157 bits (397), Expect = 1e-42 Identities = 78/90 (86%), Positives = 81/90 (90%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 V+RWSSGKEGNLR LLSTLQYILGP SGWQPI L DV+T AVKKAYRKATL VHPDKL Sbjct: 398 VRRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDVITSAAVKKAYRKATLCVHPDKLQ 457 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQ KYICEKVFDLLKEAWNKFNSEE Sbjct: 458 QRGASIQHKYICEKVFDLLKEAWNKFNSEE 487 >XP_019075039.1 PREDICTED: auxilin-like protein 1 isoform X3 [Vitis vinifera] Length = 1299 Score = 161 bits (407), Expect = 1e-42 Identities = 81/90 (90%), Positives = 83/90 (92%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGKEGNLR LLSTLQYILGP SGWQPI L DV+T VAVKKAYRKATL VHPDKL Sbjct: 1209 VKRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDVITAVAVKKAYRKATLCVHPDKLQ 1268 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKYICEKVFDLLKEAWNKFNSEE Sbjct: 1269 QRGASIQQKYICEKVFDLLKEAWNKFNSEE 1298 >XP_010649121.1 PREDICTED: auxilin-like protein 1 isoform X2 [Vitis vinifera] CBI17489.3 unnamed protein product, partial [Vitis vinifera] Length = 1455 Score = 161 bits (407), Expect = 1e-42 Identities = 81/90 (90%), Positives = 83/90 (92%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGKEGNLR LLSTLQYILGP SGWQPI L DV+T VAVKKAYRKATL VHPDKL Sbjct: 1365 VKRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDVITAVAVKKAYRKATLCVHPDKLQ 1424 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKYICEKVFDLLKEAWNKFNSEE Sbjct: 1425 QRGASIQQKYICEKVFDLLKEAWNKFNSEE 1454 >XP_002266275.1 PREDICTED: auxilin-like protein 1 isoform X1 [Vitis vinifera] Length = 1458 Score = 161 bits (407), Expect = 1e-42 Identities = 81/90 (90%), Positives = 83/90 (92%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGKEGNLR LLSTLQYILGP SGWQPI L DV+T VAVKKAYRKATL VHPDKL Sbjct: 1368 VKRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTDVITAVAVKKAYRKATLCVHPDKLQ 1427 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKYICEKVFDLLKEAWNKFNSEE Sbjct: 1428 QRGASIQQKYICEKVFDLLKEAWNKFNSEE 1457 >XP_003516401.2 PREDICTED: auxilin-like protein 1 [Glycine max] Length = 443 Score = 155 bits (391), Expect = 4e-42 Identities = 77/90 (85%), Positives = 80/90 (88%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGK GNLR LLSTLQYILGP SGWQPI L D+VT AVKKAYRKATL VHPDKL Sbjct: 353 VKRWSSGKTGNLRALLSTLQYILGPDSGWQPIPLTDIVTSTAVKKAYRKATLFVHPDKLQ 412 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKYICEKVFDLLKEAWN+FN EE Sbjct: 413 QRGASIQQKYICEKVFDLLKEAWNRFNMEE 442 >XP_019226779.1 PREDICTED: auxilin-like protein 1 [Nicotiana attenuata] OIT31826.1 auxilin-like protein 1 [Nicotiana attenuata] Length = 1430 Score = 159 bits (403), Expect = 4e-42 Identities = 78/90 (86%), Positives = 84/90 (93%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGKEGNLR LLSTLQYILGP+SGWQPI L +V+T VAVKKAYRKATL VHPDKL Sbjct: 1340 VKRWSSGKEGNLRALLSTLQYILGPNSGWQPIPLTEVITSVAVKKAYRKATLCVHPDKLQ 1399 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKY+CEKVFDLLKEAWN+FNSEE Sbjct: 1400 QRGASIQQKYVCEKVFDLLKEAWNRFNSEE 1429 >XP_009620462.1 PREDICTED: auxilin-like protein 1 [Nicotiana tomentosiformis] XP_009620463.1 PREDICTED: auxilin-like protein 1 [Nicotiana tomentosiformis] XP_009620464.1 PREDICTED: auxilin-like protein 1 [Nicotiana tomentosiformis] Length = 1434 Score = 159 bits (403), Expect = 4e-42 Identities = 78/90 (86%), Positives = 84/90 (93%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGKEGNLR LLSTLQYILGP+SGWQPI L +V+T VAVKKAYRKATL VHPDKL Sbjct: 1344 VKRWSSGKEGNLRALLSTLQYILGPNSGWQPIPLTEVITSVAVKKAYRKATLCVHPDKLQ 1403 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKY+CEKVFDLLKEAWN+FNSEE Sbjct: 1404 QRGASIQQKYVCEKVFDLLKEAWNRFNSEE 1433 >XP_015576256.1 PREDICTED: auxilin-like protein 1 [Ricinus communis] Length = 1543 Score = 159 bits (401), Expect = 8e-42 Identities = 79/90 (87%), Positives = 83/90 (92%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGKEGNLR LLSTLQYILGP+SGWQPI L +V+T AVKKAYRKATL VHPDKL Sbjct: 1453 VKRWSSGKEGNLRALLSTLQYILGPNSGWQPIPLTEVITAAAVKKAYRKATLCVHPDKLQ 1512 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKYICEKVFDLLKEAWNKFNSEE Sbjct: 1513 QRGASIQQKYICEKVFDLLKEAWNKFNSEE 1542 >OMO56932.1 hypothetical protein CCACVL1_26145 [Corchorus capsularis] Length = 1606 Score = 159 bits (401), Expect = 8e-42 Identities = 79/90 (87%), Positives = 82/90 (91%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGKEGNLR LLSTLQYILGP SGWQPI L +V+T AVKKAYRKATL VHPDKL Sbjct: 1516 VKRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTEVITSAAVKKAYRKATLCVHPDKLQ 1575 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKYICEKVFDLLKEAWNKFNSEE Sbjct: 1576 QRGASIQQKYICEKVFDLLKEAWNKFNSEE 1605 >XP_017218490.1 PREDICTED: auxilin-like protein 1 isoform X2 [Daucus carota subsp. sativus] Length = 1388 Score = 158 bits (400), Expect = 1e-41 Identities = 79/90 (87%), Positives = 82/90 (91%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGKEGNLR LLSTLQYILGP+SGWQPI L DV+T AVKKAYRKATL VHPDKL Sbjct: 1298 VKRWSSGKEGNLRALLSTLQYILGPNSGWQPIPLTDVITAAAVKKAYRKATLCVHPDKLQ 1357 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SI QKYICEKVFDLLKEAWNKFNSEE Sbjct: 1358 QRGASIHQKYICEKVFDLLKEAWNKFNSEE 1387 >XP_017218489.1 PREDICTED: auxilin-like protein 1 isoform X1 [Daucus carota subsp. sativus] KZM88883.1 hypothetical protein DCAR_025958 [Daucus carota subsp. sativus] Length = 1391 Score = 158 bits (400), Expect = 1e-41 Identities = 79/90 (87%), Positives = 82/90 (91%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGKEGNLR LLSTLQYILGP+SGWQPI L DV+T AVKKAYRKATL VHPDKL Sbjct: 1301 VKRWSSGKEGNLRALLSTLQYILGPNSGWQPIPLTDVITAAAVKKAYRKATLCVHPDKLQ 1360 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SI QKYICEKVFDLLKEAWNKFNSEE Sbjct: 1361 QRGASIHQKYICEKVFDLLKEAWNKFNSEE 1390 >XP_011658022.1 PREDICTED: auxilin-like protein 1 isoform X4 [Cucumis sativus] KGN48846.1 hypothetical protein Csa_6G502820 [Cucumis sativus] Length = 1433 Score = 158 bits (400), Expect = 1e-41 Identities = 79/90 (87%), Positives = 83/90 (92%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 V+RWSSGKEGNLR LLSTLQYILGP SGWQPI L +V+T VAVKKAYRKATL VHPDKL Sbjct: 1343 VRRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTEVITAVAVKKAYRKATLCVHPDKLQ 1402 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKYICEKVFDLLKEAWNKFNSEE Sbjct: 1403 QRGASIQQKYICEKVFDLLKEAWNKFNSEE 1432 >XP_016475588.1 PREDICTED: auxilin-like protein 1 [Nicotiana tabacum] XP_016475589.1 PREDICTED: auxilin-like protein 1 [Nicotiana tabacum] Length = 1434 Score = 158 bits (400), Expect = 1e-41 Identities = 77/90 (85%), Positives = 84/90 (93%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGKEGNLR LLSTLQYILGP+SGWQPI L +V+T VAVKKAYRKATL VHPDKL Sbjct: 1344 VKRWSSGKEGNLRALLSTLQYILGPNSGWQPIPLTEVITSVAVKKAYRKATLCVHPDKLQ 1403 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG++IQQKY+CEKVFDLLKEAWN+FNSEE Sbjct: 1404 QRGANIQQKYVCEKVFDLLKEAWNRFNSEE 1433 >XP_009759958.1 PREDICTED: auxilin-like protein 1 [Nicotiana sylvestris] XP_009759959.1 PREDICTED: auxilin-like protein 1 [Nicotiana sylvestris] Length = 1434 Score = 158 bits (400), Expect = 1e-41 Identities = 77/90 (85%), Positives = 84/90 (93%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 VKRWSSGKEGNLR LLSTLQYILGP+SGWQPI L +V+T VAVKKAYRKATL VHPDKL Sbjct: 1344 VKRWSSGKEGNLRALLSTLQYILGPNSGWQPIPLTEVITSVAVKKAYRKATLCVHPDKLQ 1403 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG++IQQKY+CEKVFDLLKEAWN+FNSEE Sbjct: 1404 QRGANIQQKYVCEKVFDLLKEAWNRFNSEE 1433 >XP_008440742.1 PREDICTED: auxilin-like protein 1 isoform X4 [Cucumis melo] Length = 1434 Score = 158 bits (400), Expect = 1e-41 Identities = 79/90 (87%), Positives = 83/90 (92%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 V+RWSSGKEGNLR LLSTLQYILGP SGWQPI L +V+T VAVKKAYRKATL VHPDKL Sbjct: 1344 VRRWSSGKEGNLRALLSTLQYILGPDSGWQPIHLTEVITAVAVKKAYRKATLCVHPDKLQ 1403 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKYICEKVFDLLKEAWNKFNSEE Sbjct: 1404 QRGASIQQKYICEKVFDLLKEAWNKFNSEE 1433 >XP_011658021.1 PREDICTED: auxilin-like protein 1 isoform X3 [Cucumis sativus] Length = 1439 Score = 158 bits (400), Expect = 1e-41 Identities = 79/90 (87%), Positives = 83/90 (92%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 V+RWSSGKEGNLR LLSTLQYILGP SGWQPI L +V+T VAVKKAYRKATL VHPDKL Sbjct: 1349 VRRWSSGKEGNLRALLSTLQYILGPDSGWQPIPLTEVITAVAVKKAYRKATLCVHPDKLQ 1408 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKYICEKVFDLLKEAWNKFNSEE Sbjct: 1409 QRGASIQQKYICEKVFDLLKEAWNKFNSEE 1438 >XP_008440741.1 PREDICTED: auxilin-like protein 1 isoform X3 [Cucumis melo] Length = 1440 Score = 158 bits (400), Expect = 1e-41 Identities = 79/90 (87%), Positives = 83/90 (92%), Gaps = 1/90 (1%) Frame = -1 Query: 527 VKRWSSGKEGNLRTLLSTLQYILGPHSGWQPILLIDVVTDVAVKKAYRKATLRVHPDKL- 351 V+RWSSGKEGNLR LLSTLQYILGP SGWQPI L +V+T VAVKKAYRKATL VHPDKL Sbjct: 1350 VRRWSSGKEGNLRALLSTLQYILGPDSGWQPIHLTEVITAVAVKKAYRKATLCVHPDKLQ 1409 Query: 350 QRGSSIQQKYICEKVFDLLKEAWNKFNSEE 261 QRG+SIQQKYICEKVFDLLKEAWNKFNSEE Sbjct: 1410 QRGASIQQKYICEKVFDLLKEAWNKFNSEE 1439