BLASTX nr result
ID: Panax25_contig00039945
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00039945 (369 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017253731.1 PREDICTED: kinesin-like protein KIN-7G [Daucus ca... 71 5e-12 >XP_017253731.1 PREDICTED: kinesin-like protein KIN-7G [Daucus carota subsp. sativus] KZM94098.1 hypothetical protein DCAR_017343 [Daucus carota subsp. sativus] Length = 998 Score = 71.2 bits (173), Expect = 5e-12 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +2 Query: 251 MGASDGGEEVGMGEGHDEKIFVSVRLRPMNRKEIARNDV 367 MGASD GEEVGM GHDEKIFV+VRLRP+NRKEIARNDV Sbjct: 1 MGASDVGEEVGMAGGHDEKIFVTVRLRPLNRKEIARNDV 39