BLASTX nr result
ID: Panax25_contig00039940
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00039940 (605 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAN78352.1 hypothetical protein VITISV_022840 [Vitis vinifera] 49 6e-07 >CAN78352.1 hypothetical protein VITISV_022840 [Vitis vinifera] Length = 1038 Score = 49.3 bits (116), Expect(2) = 6e-07 Identities = 21/49 (42%), Positives = 31/49 (63%) Frame = +3 Query: 3 LKMSRIDSFLVTLHWEEIFPDVS*MCFVRPIFKHVPLLLDSGGIQGSKV 149 ++ SR+D FL++ WE F VS RP+F H P+LLD GG++ S + Sbjct: 120 MRRSRLDRFLISEDWENHFSGVSQSTLPRPVFDHFPILLDGGGVRRSPI 168 Score = 31.6 bits (70), Expect(2) = 6e-07 Identities = 13/19 (68%), Positives = 15/19 (78%) Frame = +1 Query: 151 FCFENMRLKVNGFVEMVKG 207 FCFENM LK GF E++KG Sbjct: 170 FCFENMWLKEKGFKELLKG 188