BLASTX nr result
ID: Panax25_contig00039777
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00039777 (464 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM96720.1 hypothetical protein DCAR_015918 [Daucus carota subsp... 55 2e-06 XP_017245180.1 PREDICTED: MADS-box protein SOC1-like [Daucus car... 55 4e-06 >KZM96720.1 hypothetical protein DCAR_015918 [Daucus carota subsp. sativus] Length = 150 Score = 54.7 bits (130), Expect = 2e-06 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +3 Query: 210 QVQPRQGSNEEKELLPSIETSENSDVETELFIGLRKKSSS 329 ++QP Q SNE+KE PS ET ENSDVETEL+IGLRKK SS Sbjct: 111 ELQPPQESNEDKEYSPSTET-ENSDVETELYIGLRKKISS 149 >XP_017245180.1 PREDICTED: MADS-box protein SOC1-like [Daucus carota subsp. sativus] XP_017245181.1 PREDICTED: MADS-box protein SOC1-like [Daucus carota subsp. sativus] XP_017245182.1 PREDICTED: MADS-box protein SOC1-like [Daucus carota subsp. sativus] XP_017245183.1 PREDICTED: MADS-box protein SOC1-like [Daucus carota subsp. sativus] XP_017245184.1 PREDICTED: MADS-box protein SOC1-like [Daucus carota subsp. sativus] Length = 211 Score = 54.7 bits (130), Expect = 4e-06 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +3 Query: 210 QVQPRQGSNEEKELLPSIETSENSDVETELFIGLRKKSSS 329 ++QP Q SNE+KE PS ET ENSDVETEL+IGLRKK SS Sbjct: 172 ELQPPQESNEDKEYSPSTET-ENSDVETELYIGLRKKISS 210