BLASTX nr result
ID: Panax25_contig00039449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00039449 (425 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KOM34692.1 hypothetical protein LR48_Vigan02g084200 [Vigna angul... 52 2e-06 >KOM34692.1 hypothetical protein LR48_Vigan02g084200 [Vigna angularis] Length = 87 Score = 52.4 bits (124), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 147 SNLIKAVPDEHKKFLADLVWVHEEFRLVFSTTI 245 ++L+KAVPDEHKKFLADLVWVHEE L+ S TI Sbjct: 8 ADLVKAVPDEHKKFLADLVWVHEE-ELIASPTI 39