BLASTX nr result
ID: Panax25_contig00039312
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00039312 (473 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010228504.1 PREDICTED: uncharacterized protein LOC104581761 [... 54 9e-06 >XP_010228504.1 PREDICTED: uncharacterized protein LOC104581761 [Brachypodium distachyon] KQK21287.1 hypothetical protein BRADI_1g59974 [Brachypodium distachyon] Length = 232 Score = 53.9 bits (128), Expect = 9e-06 Identities = 26/60 (43%), Positives = 36/60 (60%), Gaps = 6/60 (10%) Frame = +1 Query: 301 DSQIDNASMDK------PKVRKAENYTVAEDLIIIAAWEHTSEDVVIGTDQAKEQYWTRV 462 D+Q+D D+ PK R+A NYT AEDL+++ AW+ D +GTDQ K YW R+ Sbjct: 71 DTQLDGGLDDEGFIDEMPKGRRA-NYTTAEDLLLVKAWQKVGMDAAVGTDQPKALYWVRI 129