BLASTX nr result
ID: Panax25_contig00039006
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00039006 (455 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019161501.1 PREDICTED: probable magnesium transporter NIPA8 i... 79 3e-14 XP_019161498.1 PREDICTED: probable magnesium transporter NIPA8 i... 79 3e-14 KZV42039.1 hypothetical protein F511_18385 [Dorcoceras hygrometr... 77 8e-14 XP_011098988.1 PREDICTED: probable magnesium transporter NIPA8 [... 77 2e-13 XP_015893927.1 PREDICTED: probable magnesium transporter NIPA8 [... 77 2e-13 XP_008449977.1 PREDICTED: probable magnesium transporter NIPA8 [... 76 3e-13 XP_019052484.1 PREDICTED: probable magnesium transporter NIPA8 i... 75 4e-13 XP_019052483.1 PREDICTED: probable magnesium transporter NIPA8 i... 75 5e-13 XP_016561766.1 PREDICTED: probable magnesium transporter NIPA8 i... 75 5e-13 XP_010554143.1 PREDICTED: probable magnesium transporter NIPA8 [... 75 5e-13 XP_019052485.1 PREDICTED: probable magnesium transporter NIPA8 i... 75 5e-13 XP_016561765.1 PREDICTED: probable magnesium transporter NIPA8 i... 75 5e-13 KGN57684.1 hypothetical protein Csa_3G251940 [Cucumis sativus] 74 9e-13 CDP16754.1 unnamed protein product [Coffea canephora] 74 1e-12 XP_010528116.1 PREDICTED: probable magnesium transporter NIPA8 i... 74 1e-12 XP_010528114.1 PREDICTED: probable magnesium transporter NIPA8 i... 74 1e-12 XP_004145621.2 PREDICTED: probable magnesium transporter NIPA8 [... 74 1e-12 XP_006338750.1 PREDICTED: probable magnesium transporter NIPA8 [... 74 1e-12 XP_006395536.1 hypothetical protein EUTSA_v10004224mg [Eutrema s... 74 2e-12 XP_010090937.1 hypothetical protein L484_007572 [Morus notabilis... 74 2e-12 >XP_019161501.1 PREDICTED: probable magnesium transporter NIPA8 isoform X2 [Ipomoea nil] Length = 448 Score = 78.6 bits (192), Expect = 3e-14 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S YR+GE L+SVP NDLK YW MLL FSYAIVSGAVGSCSVLFAKS Sbjct: 166 SIYRRGEQLLSVPGNDLKPYWQMLLPFSYAIVSGAVGSCSVLFAKS 211 >XP_019161498.1 PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Ipomoea nil] XP_019161499.1 PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Ipomoea nil] XP_019161500.1 PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Ipomoea nil] Length = 450 Score = 78.6 bits (192), Expect = 3e-14 Identities = 38/46 (82%), Positives = 40/46 (86%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S YR+GE L+SVP NDLK YW MLL FSYAIVSGAVGSCSVLFAKS Sbjct: 166 SIYRRGEQLLSVPGNDLKPYWQMLLPFSYAIVSGAVGSCSVLFAKS 211 >KZV42039.1 hypothetical protein F511_18385 [Dorcoceras hygrometricum] Length = 446 Score = 77.4 bits (189), Expect = 8e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S YRKGE L++ P ND+K YWHMLL FSYAIVSGAVGSCSVLFAKS Sbjct: 166 SIYRKGELLLANPGNDIKPYWHMLLPFSYAIVSGAVGSCSVLFAKS 211 >XP_011098988.1 PREDICTED: probable magnesium transporter NIPA8 [Sesamum indicum] XP_011098989.1 PREDICTED: probable magnesium transporter NIPA8 [Sesamum indicum] XP_011098990.1 PREDICTED: probable magnesium transporter NIPA8 [Sesamum indicum] Length = 436 Score = 76.6 bits (187), Expect = 2e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S YR+GE L++VP ND+K YWHMLL SYAIVSGAVGSCSVLFAKS Sbjct: 166 SIYRRGELLLAVPGNDIKPYWHMLLPLSYAIVSGAVGSCSVLFAKS 211 >XP_015893927.1 PREDICTED: probable magnesium transporter NIPA8 [Ziziphus jujuba] XP_015893928.1 PREDICTED: probable magnesium transporter NIPA8 [Ziziphus jujuba] XP_015893929.1 PREDICTED: probable magnesium transporter NIPA8 [Ziziphus jujuba] XP_015893930.1 PREDICTED: probable magnesium transporter NIPA8 [Ziziphus jujuba] XP_015893931.1 PREDICTED: probable magnesium transporter NIPA8 [Ziziphus jujuba] Length = 441 Score = 76.6 bits (187), Expect = 2e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S YRKGE +I+VP DL+ YWHMLL FSYA+VSGAVGSCSVLFAKS Sbjct: 166 SIYRKGELVIAVPGQDLRPYWHMLLPFSYAVVSGAVGSCSVLFAKS 211 >XP_008449977.1 PREDICTED: probable magnesium transporter NIPA8 [Cucumis melo] XP_008449978.1 PREDICTED: probable magnesium transporter NIPA8 [Cucumis melo] Length = 444 Score = 75.9 bits (185), Expect = 3e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S YR+GE L+SV DL+SYWHMLL FSYAIVSGA+GSCSVLFAKS Sbjct: 166 SIYRRGELLLSVSGQDLRSYWHMLLPFSYAIVSGAIGSCSVLFAKS 211 >XP_019052484.1 PREDICTED: probable magnesium transporter NIPA8 isoform X2 [Nelumbo nucifera] Length = 354 Score = 75.1 bits (183), Expect = 4e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S YR+GE +++V NDL SYWHMLL FSYA+VSGAVGSCSVLFAKS Sbjct: 166 SIYRRGELMLAVSVNDLSSYWHMLLPFSYAVVSGAVGSCSVLFAKS 211 >XP_019052483.1 PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Nelumbo nucifera] Length = 384 Score = 75.1 bits (183), Expect = 5e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S YR+GE +++V NDL SYWHMLL FSYA+VSGAVGSCSVLFAKS Sbjct: 166 SIYRRGELMLAVSVNDLSSYWHMLLPFSYAVVSGAVGSCSVLFAKS 211 >XP_016561766.1 PREDICTED: probable magnesium transporter NIPA8 isoform X2 [Capsicum annuum] Length = 392 Score = 75.1 bits (183), Expect = 5e-13 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S Y++GE ++SVP N+ K YWHMLL FSYA+VSGAVGSCSVLFAKS Sbjct: 114 SIYKRGELMLSVPMNESKPYWHMLLPFSYAVVSGAVGSCSVLFAKS 159 >XP_010554143.1 PREDICTED: probable magnesium transporter NIPA8 [Tarenaya hassleriana] XP_010554144.1 PREDICTED: probable magnesium transporter NIPA8 [Tarenaya hassleriana] Length = 434 Score = 75.1 bits (183), Expect = 5e-13 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -1 Query: 134 YRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 YRKGE LIS P +L+ YWHMLL FSYA+VSGA+GSCSVLFAKS Sbjct: 166 YRKGELLISAPGQELRPYWHMLLPFSYAVVSGAIGSCSVLFAKS 209 >XP_019052485.1 PREDICTED: probable magnesium transporter NIPA8 isoform X3 [Nelumbo nucifera] Length = 441 Score = 75.1 bits (183), Expect = 5e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S YR+GE +++V NDL SYWHMLL FSYA+VSGAVGSCSVLFAKS Sbjct: 166 SIYRRGELMLAVSVNDLSSYWHMLLPFSYAVVSGAVGSCSVLFAKS 211 >XP_016561765.1 PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Capsicum annuum] Length = 444 Score = 75.1 bits (183), Expect = 5e-13 Identities = 34/46 (73%), Positives = 40/46 (86%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S Y++GE ++SVP N+ K YWHMLL FSYA+VSGAVGSCSVLFAKS Sbjct: 166 SIYKRGELMLSVPMNESKPYWHMLLPFSYAVVSGAVGSCSVLFAKS 211 >KGN57684.1 hypothetical protein Csa_3G251940 [Cucumis sativus] Length = 333 Score = 73.9 bits (180), Expect = 9e-13 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S YR+GE L+SV DL+ YWHMLL FSYAIVSGA+GSCSVLFAKS Sbjct: 166 SIYRRGELLLSVSGQDLRPYWHMLLPFSYAIVSGAIGSCSVLFAKS 211 >CDP16754.1 unnamed protein product [Coffea canephora] Length = 442 Score = 74.3 bits (181), Expect = 1e-12 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S YR+GE L++VP DLK YW MLL FSYAIVSGAVGSCSVLFAKS Sbjct: 162 SIYRRGELLLAVPGQDLKPYWQMLLPFSYAIVSGAVGSCSVLFAKS 207 >XP_010528116.1 PREDICTED: probable magnesium transporter NIPA8 isoform X2 [Tarenaya hassleriana] Length = 424 Score = 73.9 bits (180), Expect = 1e-12 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -1 Query: 134 YRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 YRKGE L+SVP L YWHMLL FSYA+VSGA+GSCSVLFAKS Sbjct: 162 YRKGELLLSVPGQQLTPYWHMLLPFSYAVVSGAIGSCSVLFAKS 205 >XP_010528114.1 PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Tarenaya hassleriana] XP_010528115.1 PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Tarenaya hassleriana] XP_019057078.1 PREDICTED: probable magnesium transporter NIPA8 isoform X1 [Tarenaya hassleriana] Length = 428 Score = 73.9 bits (180), Expect = 1e-12 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = -1 Query: 134 YRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 YRKGE L+SVP L YWHMLL FSYA+VSGA+GSCSVLFAKS Sbjct: 166 YRKGELLLSVPGQQLTPYWHMLLPFSYAVVSGAIGSCSVLFAKS 209 >XP_004145621.2 PREDICTED: probable magnesium transporter NIPA8 [Cucumis sativus] Length = 444 Score = 73.9 bits (180), Expect = 1e-12 Identities = 35/46 (76%), Positives = 39/46 (84%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S YR+GE L+SV DL+ YWHMLL FSYAIVSGA+GSCSVLFAKS Sbjct: 166 SIYRRGELLLSVSGQDLRPYWHMLLPFSYAIVSGAIGSCSVLFAKS 211 >XP_006338750.1 PREDICTED: probable magnesium transporter NIPA8 [Solanum tuberosum] Length = 457 Score = 73.9 bits (180), Expect = 1e-12 Identities = 33/46 (71%), Positives = 40/46 (86%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S Y++GE +++VP N+ K YWHMLL FSYA+VSGAVGSCSVLFAKS Sbjct: 166 SIYKRGELMLAVPMNESKPYWHMLLPFSYAVVSGAVGSCSVLFAKS 211 >XP_006395536.1 hypothetical protein EUTSA_v10004224mg [Eutrema salsugineum] ESQ32822.1 hypothetical protein EUTSA_v10004224mg [Eutrema salsugineum] Length = 444 Score = 73.6 bits (179), Expect = 2e-12 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = -1 Query: 134 YRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 YRKGE LISVP ++ SYW MLL FSYA+VSGA+GSCSVLFAKS Sbjct: 166 YRKGEVLISVPGQEISSYWKMLLPFSYAVVSGAIGSCSVLFAKS 209 >XP_010090937.1 hypothetical protein L484_007572 [Morus notabilis] EXB41422.1 hypothetical protein L484_007572 [Morus notabilis] Length = 453 Score = 73.6 bits (179), Expect = 2e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -1 Query: 140 SEYRKGESLISVPRNDLKSYWHMLLSFSYAIVSGAVGSCSVLFAKS 3 S YR+GE L++V +DL+ YWHMLL FSYAIVSGAVGSCSVLFAKS Sbjct: 171 SIYRRGELLLAVSGHDLRPYWHMLLPFSYAIVSGAVGSCSVLFAKS 216