BLASTX nr result
ID: Panax25_contig00038485
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00038485 (1466 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CRL21148.1 Zinc finger, CCHC-type [Penicillium camemberti] 60 4e-06 KOS44230.1 hypothetical protein ACN38_g4860 [Penicillium nordicum] 60 4e-06 >CRL21148.1 Zinc finger, CCHC-type [Penicillium camemberti] Length = 490 Score = 60.5 bits (145), Expect = 4e-06 Identities = 27/58 (46%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -2 Query: 241 CYICGCEGHTSPRCPN-YKQGGCFNCGMEGHRANECPRKRLGK*VVWVMLCLCNVCDK 71 CY CG EGH+ CP K G CFNCG EGH +ECP+ R+ K C +C+K Sbjct: 68 CYNCGQEGHSKAECPEPRKMGACFNCGEEGHSKSECPKPRVFK-------GTCRICEK 118 >KOS44230.1 hypothetical protein ACN38_g4860 [Penicillium nordicum] Length = 533 Score = 60.5 bits (145), Expect = 4e-06 Identities = 27/58 (46%), Positives = 33/58 (56%), Gaps = 1/58 (1%) Frame = -2 Query: 241 CYICGCEGHTSPRCPN-YKQGGCFNCGMEGHRANECPRKRLGK*VVWVMLCLCNVCDK 71 CY CG EGH+ CP K G CFNCG EGH +ECP+ R+ K C +C+K Sbjct: 111 CYNCGQEGHSKAECPEPRKMGACFNCGEEGHSKSECPKPRVFK-------GTCRICEK 161