BLASTX nr result
ID: Panax25_contig00038423
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00038423 (387 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZM97459.1 hypothetical protein DCAR_015179 [Daucus carota subsp... 67 7e-12 XP_017248122.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Dau... 67 2e-11 XP_017250093.1 PREDICTED: ubiquitin-conjugating enzyme E2 7-like... 67 2e-11 XP_010651046.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 isof... 66 3e-11 XP_010651045.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 isof... 66 3e-11 KJB20126.1 hypothetical protein B456_003G134400 [Gossypium raimo... 65 4e-11 KJB08669.1 hypothetical protein B456_001G108800 [Gossypium raimo... 65 4e-11 XP_014494603.1 PREDICTED: ubiquitin-conjugating enzyme E2 7-like... 66 4e-11 XP_008457496.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Cuc... 66 4e-11 XP_002284116.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 isof... 66 5e-11 KJB20130.1 hypothetical protein B456_003G134400 [Gossypium raimo... 65 5e-11 XP_016732895.1 PREDICTED: ubiquitin-conjugating enzyme E2 7-like... 65 5e-11 KJB20125.1 hypothetical protein B456_003G134400 [Gossypium raimo... 65 5e-11 XP_010651042.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 isof... 66 5e-11 XP_010535507.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Tar... 66 6e-11 XP_015952269.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Ara... 66 6e-11 XP_011091476.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Ses... 66 6e-11 XP_010685799.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Bet... 66 6e-11 XP_019160071.1 PREDICTED: ubiquitin-conjugating enzyme E2 7-like... 66 7e-11 XP_019192087.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Ipo... 66 7e-11 >KZM97459.1 hypothetical protein DCAR_015179 [Daucus carota subsp. sativus] Length = 116 Score = 67.0 bits (162), Expect = 7e-12 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP Sbjct: 15 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 44 >XP_017248122.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Daucus carota subsp. sativus] Length = 166 Score = 67.0 bits (162), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP Sbjct: 15 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 44 >XP_017250093.1 PREDICTED: ubiquitin-conjugating enzyme E2 7-like [Daucus carota subsp. sativus] Length = 168 Score = 67.0 bits (162), Expect = 2e-11 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP Sbjct: 17 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 46 >XP_010651046.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 isoform X5 [Vitis vinifera] XP_010651047.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 isoform X5 [Vitis vinifera] Length = 149 Score = 66.2 bits (160), Expect = 3e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDESN+FEWSVTIIGP Sbjct: 19 DLCKNPVDGFSAGLVDESNIFEWSVTIIGP 48 >XP_010651045.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 isoform X4 [Vitis vinifera] Length = 154 Score = 66.2 bits (160), Expect = 3e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDESN+FEWSVTIIGP Sbjct: 19 DLCKNPVDGFSAGLVDESNIFEWSVTIIGP 48 >KJB20126.1 hypothetical protein B456_003G134400 [Gossypium raimondii] Length = 118 Score = 65.1 bits (157), Expect = 4e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDE+N+FEWSVTIIGP Sbjct: 15 DLCKNPVDGFSAGLVDENNIFEWSVTIIGP 44 >KJB08669.1 hypothetical protein B456_001G108800 [Gossypium raimondii] Length = 118 Score = 65.1 bits (157), Expect = 4e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDE+N+FEWSVTIIGP Sbjct: 15 DLCKNPVDGFSAGLVDENNIFEWSVTIIGP 44 >XP_014494603.1 PREDICTED: ubiquitin-conjugating enzyme E2 7-like [Vigna radiata var. radiata] XP_017406355.1 PREDICTED: ubiquitin-conjugating enzyme E2 7-like [Vigna angularis] KOM26179.1 hypothetical protein LR48_Vigan238s001200 [Vigna angularis] BAT90708.1 hypothetical protein VIGAN_06198800 [Vigna angularis var. angularis] Length = 166 Score = 66.2 bits (160), Expect = 4e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDESN+FEWSVTIIGP Sbjct: 15 DLCKNPVDGFSAGLVDESNIFEWSVTIIGP 44 >XP_008457496.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Cucumis melo] XP_011658058.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Cucumis sativus] KGN65703.1 hypothetical protein Csa_1G503400 [Cucumis sativus] Length = 167 Score = 66.2 bits (160), Expect = 4e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDESN+FEWSVTIIGP Sbjct: 16 DLCKNPVDGFSAGLVDESNIFEWSVTIIGP 45 >XP_002284116.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 isoform X3 [Vitis vinifera] Length = 170 Score = 66.2 bits (160), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDESN+FEWSVTIIGP Sbjct: 19 DLCKNPVDGFSAGLVDESNIFEWSVTIIGP 48 >KJB20130.1 hypothetical protein B456_003G134400 [Gossypium raimondii] Length = 123 Score = 65.1 bits (157), Expect = 5e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDE+N+FEWSVTIIGP Sbjct: 15 DLCKNPVDGFSAGLVDENNIFEWSVTIIGP 44 >XP_016732895.1 PREDICTED: ubiquitin-conjugating enzyme E2 7-like [Gossypium hirsutum] Length = 124 Score = 65.1 bits (157), Expect = 5e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDE+N+FEWSVTIIGP Sbjct: 15 DLCKNPVDGFSAGLVDENNIFEWSVTIIGP 44 >KJB20125.1 hypothetical protein B456_003G134400 [Gossypium raimondii] Length = 124 Score = 65.1 bits (157), Expect = 5e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDE+N+FEWSVTIIGP Sbjct: 15 DLCKNPVDGFSAGLVDENNIFEWSVTIIGP 44 >XP_010651042.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 isoform X2 [Vitis vinifera] XP_010651043.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 isoform X2 [Vitis vinifera] XP_010651044.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 isoform X2 [Vitis vinifera] CBI16161.3 unnamed protein product, partial [Vitis vinifera] Length = 176 Score = 66.2 bits (160), Expect = 5e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDESN+FEWSVTIIGP Sbjct: 19 DLCKNPVDGFSAGLVDESNIFEWSVTIIGP 48 >XP_010535507.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Tarenaya hassleriana] Length = 166 Score = 65.9 bits (159), Expect = 6e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDESN+FEWSVTIIGP Sbjct: 15 DLCKNPVDGFSAGLVDESNVFEWSVTIIGP 44 >XP_015952269.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Arachis duranensis] XP_016187302.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Arachis ipaensis] ABI84264.1 ubiquitin-conjugating enzyme [Arachis hypogaea] Length = 166 Score = 65.9 bits (159), Expect = 6e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDESN+FEWSVT+IGP Sbjct: 15 DLCKNPVDGFSAGLVDESNIFEWSVTVIGP 44 >XP_011091476.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Sesamum indicum] Length = 168 Score = 65.9 bits (159), Expect = 6e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGL+DESNLFEWSVTIIGP Sbjct: 17 DLCKNPVDGFSAGLLDESNLFEWSVTIIGP 46 >XP_010685799.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Beta vulgaris subsp. vulgaris] KMT05282.1 hypothetical protein BVRB_7g174200 [Beta vulgaris subsp. vulgaris] Length = 168 Score = 65.9 bits (159), Expect = 6e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDE+NLFEWSVTIIGP Sbjct: 17 DLCKNPVDGFSAGLVDENNLFEWSVTIIGP 46 >XP_019160071.1 PREDICTED: ubiquitin-conjugating enzyme E2 7-like [Ipomoea nil] Length = 170 Score = 65.9 bits (159), Expect = 7e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDE+NLFEWSVTIIGP Sbjct: 19 DLCKNPVDGFSAGLVDENNLFEWSVTIIGP 48 >XP_019192087.1 PREDICTED: ubiquitin-conjugating enzyme E2 7 [Ipomoea nil] Length = 170 Score = 65.9 bits (159), Expect = 7e-11 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -3 Query: 91 DLCKNPVDGFSAGLVDESNLFEWSVTIIGP 2 DLCKNPVDGFSAGLVDE+NLFEWSVTIIGP Sbjct: 19 DLCKNPVDGFSAGLVDENNLFEWSVTIIGP 48