BLASTX nr result
ID: Panax25_contig00037405
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00037405 (769 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_009241115.1 Ycf2 (chloroplast) [Schefflera heptaphylla] YP_00... 74 3e-11 YP_009266562.1 Ycf2 (chloroplast) [Panax stipuleanatus] YP_00926... 74 4e-11 YP_009191983.1 hypothetical protein RF2 (chloroplast) [Panax vie... 74 4e-11 YP_009191896.1 hypothetical protein RF2 (chloroplast) [Panax jap... 74 4e-11 YP_087009.1 Ycf2 [Panax ginseng] YP_087028.1 Ycf2 [Panax ginseng... 74 4e-11 YP_009155471.1 Ycf2 (chloroplast) [Panax quinquefolius] YP_00915... 74 4e-11 AKU70820.1 hypothetical chloroplast RF21 (chloroplast) [Panax no... 74 4e-11 ANS71899.1 Ycf2 (chloroplast) [Eleutherococcus gracilistylus] AN... 74 4e-11 YP_009159581.1 Ycf2 (chloroplast) [Dendropanax morbifer] YP_0091... 74 4e-11 YP_008815248.1 hypothetical chloroplast RF21 (chloroplast) [Kalo... 74 4e-11 YP_008815074.1 hypothetical chloroplast RF21 (chloroplast) [Meta... 74 4e-11 YP_009122769.1 ycf2 (chloroplast) [Dendropanax dentiger] YP_0091... 74 4e-11 YP_009121217.1 hypothetical chloroplast RF21 (chloroplast) [Pana... 74 4e-11 YP_004935596.1 ycf2 (chloroplast) [Eleutherococcus senticosus] Y... 74 4e-11 YP_009161723.1 hypothetical chloroplast RF21 (chloroplast) [Fats... 74 4e-11 ANS71986.1 Ycf2 (chloroplast) [Aralia elata] ANS72006.1 Ycf2 (ch... 74 4e-11 YP_008815161.1 hypothetical chloroplast RF21 (chloroplast) [Sche... 74 4e-11 YP_008814900.1 hypothetical chloroplast RF21 (chloroplast) [Aral... 74 4e-11 YP_008814987.1 hypothetical chloroplast RF21 (chloroplast) [Bras... 72 2e-10 ANS71812.1 Ycf2 (chloroplast) [Eleutherococcus sessiliflorus] AN... 71 3e-10 >YP_009241115.1 Ycf2 (chloroplast) [Schefflera heptaphylla] YP_009241095.1 Ycf2 (chloroplast) [Schefflera heptaphylla] AMK46217.1 Ycf2 (chloroplast) [Schefflera heptaphylla] AMK46224.1 Ycf2 (chloroplast) [Schefflera heptaphylla] Length = 1467 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_009266562.1 Ycf2 (chloroplast) [Panax stipuleanatus] YP_009266580.1 Ycf2 (chloroplast) [Panax stipuleanatus] ANK78374.1 Ycf2 (chloroplast) [Panax japonicus var. bipinnatifidus] ANK78392.1 Ycf2 (chloroplast) [Panax japonicus var. bipinnatifidus] ANK78460.1 Ycf2 (chloroplast) [Panax stipuleanatus] ANK78478.1 Ycf2 (chloroplast) [Panax stipuleanatus] Length = 2103 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_009191983.1 hypothetical protein RF2 (chloroplast) [Panax vietnamensis] YP_009192003.1 hypothetical protein RF2 (chloroplast) [Panax vietnamensis] AKB99289.1 hypothetical protein RF2 (chloroplast) [Panax vietnamensis] AKB99309.1 hypothetical protein RF2 (chloroplast) [Panax vietnamensis] AKB99376.1 hypothetical protein RF2 (chloroplast) [Panax vietnamensis] AKB99396.1 hypothetical protein RF2 (chloroplast) [Panax vietnamensis] AMR97492.1 Ycf2 (chloroplast) [Panax vietnamensis] AMR97510.1 Ycf2 (chloroplast) [Panax vietnamensis] Length = 2104 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_009191896.1 hypothetical protein RF2 (chloroplast) [Panax japonicus] YP_009191916.1 hypothetical protein RF2 (chloroplast) [Panax japonicus] AKB99202.1 hypothetical protein RF2 (chloroplast) [Panax japonicus] AKB99222.1 hypothetical protein RF2 (chloroplast) [Panax japonicus] Length = 2110 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_087009.1 Ycf2 [Panax ginseng] YP_087028.1 Ycf2 [Panax ginseng] Q68RU4.1 RecName: Full=Protein Ycf2 AAT98552.1 ycf2 protein (chloroplast) [Panax ginseng] AAT98573.1 ycf2 protein (chloroplast) [Panax ginseng] AGM15034.1 Ycf2 (chloroplast) [Panax ginseng] AGM15035.1 Ycf2 (chloroplast) [Panax ginseng] AGM15120.1 Ycf2 (chloroplast) [Panax ginseng] AGM15121.1 Ycf2 (chloroplast) [Panax ginseng] AGM15206.1 Ycf2 (chloroplast) [Panax ginseng] AGM15207.1 Ycf2 (chloroplast) [Panax ginseng] AGW31966.1 Ycf2 (chloroplast) [Panax ginseng] AGW31967.1 Ycf2 (chloroplast) [Panax ginseng] AIX97932.1 Ycf2 (chloroplast) [Panax ginseng] AIX97950.1 Ycf2 (chloroplast) [Panax ginseng] AIX98018.1 Ycf2 (chloroplast) [Panax ginseng] AIX98035.1 Ycf2 (chloroplast) [Panax ginseng] AIX98102.1 Ycf2 (chloroplast) [Panax ginseng] AIX98120.1 Ycf2 (chloroplast) [Panax ginseng] AIX98187.1 Ycf2 (chloroplast) [Panax ginseng] AIX98205.1 Ycf2 (chloroplast) [Panax ginseng] AIX98272.1 Ycf2 (chloroplast) [Panax ginseng] AIX98290.1 Ycf2 (chloroplast) [Panax ginseng] AIX98357.1 Ycf2 (chloroplast) [Panax ginseng] AIX98375.1 Ycf2 (chloroplast) [Panax ginseng] AIX98442.1 Ycf2 (chloroplast) [Panax ginseng] AIX98460.1 Ycf2 (chloroplast) [Panax ginseng] AIX98527.1 Ycf2 (chloroplast) [Panax ginseng] AIX98545.1 Ycf2 (chloroplast) [Panax ginseng] AIX98612.1 Ycf2 (chloroplast) [Panax ginseng] AIX98632.1 Ycf2 (chloroplast) [Panax ginseng] AJC99616.1 Ycf2 (chloroplast) [Panax ginseng] AJC99634.1 Ycf2 (chloroplast) [Panax ginseng] AJC99701.1 Ycf2 (chloroplast) [Panax ginseng] AJC99719.1 Ycf2 (chloroplast) [Panax ginseng] Length = 2110 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_009155471.1 Ycf2 (chloroplast) [Panax quinquefolius] YP_009155489.1 Ycf2 (chloroplast) [Panax quinquefolius] AJC99531.1 Ycf2 (chloroplast) [Panax quinquefolius] AJC99549.1 Ycf2 (chloroplast) [Panax quinquefolius] AKZ29791.1 hypothetical chloroplast RF21 (chloroplast) [Panax quinquefolius] AKZ29810.1 hypothetical chloroplast RF21 (chloroplast) [Panax quinquefolius] Length = 2110 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >AKU70820.1 hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] AKU70840.1 hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] Length = 2115 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >ANS71899.1 Ycf2 (chloroplast) [Eleutherococcus gracilistylus] ANS71919.1 Ycf2 (chloroplast) [Eleutherococcus gracilistylus] Length = 2116 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_009159581.1 Ycf2 (chloroplast) [Dendropanax morbifer] YP_009159601.1 Ycf2 (chloroplast) [Dendropanax morbifer] AKQ20771.1 Ycf2 (chloroplast) [Dendropanax morbifer] AKQ20791.1 Ycf2 (chloroplast) [Dendropanax morbifer] Length = 2116 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_008815248.1 hypothetical chloroplast RF21 (chloroplast) [Kalopanax septemlobus] YP_008815267.1 hypothetical chloroplast RF21 (chloroplast) [Kalopanax septemlobus] AGG39347.1 hypothetical chloroplast RF21 (chloroplast) [Kalopanax septemlobus] AGG39368.1 hypothetical chloroplast RF21 (chloroplast) [Kalopanax septemlobus] Length = 2116 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_008815074.1 hypothetical chloroplast RF21 (chloroplast) [Metapanax delavayi] YP_008815093.1 hypothetical chloroplast RF21 (chloroplast) [Metapanax delavayi] AGG39173.1 hypothetical chloroplast RF21 (chloroplast) [Metapanax delavayi] AGG39194.1 hypothetical chloroplast RF21 (chloroplast) [Metapanax delavayi] Length = 2116 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_009122769.1 ycf2 (chloroplast) [Dendropanax dentiger] YP_009122788.1 ycf2 (chloroplast) [Dendropanax dentiger] AJK29842.1 ycf2 (chloroplast) [Dendropanax dentiger] AJK29843.1 ycf2 (chloroplast) [Dendropanax dentiger] Length = 2117 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_009121217.1 hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] YP_009121236.1 hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] AIA24371.1 hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] AIA24390.1 hypothetical chloroplast RF21 (chloroplast) [Panax notoginseng] AKB99115.1 hypothetical protein RF2 (chloroplast) [Panax notoginseng] AKB99135.1 hypothetical protein RF2 (chloroplast) [Panax notoginseng] AKG26644.1 Ycf2 (chloroplast) [Panax notoginseng] AKG26662.1 Ycf2 (chloroplast) [Panax notoginseng] Length = 2121 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_004935596.1 ycf2 (chloroplast) [Eleutherococcus senticosus] YP_004935615.1 ycf2 (chloroplast) [Eleutherococcus senticosus] AEO92663.1 ycf2 (chloroplast) [Eleutherococcus senticosus] AEO92680.1 ycf2 (chloroplast) [Eleutherococcus senticosus] Length = 2121 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_009161723.1 hypothetical chloroplast RF21 (chloroplast) [Fatsia japonica] YP_009161742.1 hypothetical chloroplast RF21 (chloroplast) [Fatsia japonica] AKS10997.1 hypothetical chloroplast RF21 (chloroplast) [Fatsia japonica] AKS11017.1 hypothetical chloroplast RF21 (chloroplast) [Fatsia japonica] Length = 2126 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >ANS71986.1 Ycf2 (chloroplast) [Aralia elata] ANS72006.1 Ycf2 (chloroplast) [Aralia elata] Length = 2127 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_008815161.1 hypothetical chloroplast RF21 (chloroplast) [Schefflera delavayi] YP_008815180.1 hypothetical chloroplast RF21 (chloroplast) [Schefflera delavayi] AGG39260.1 hypothetical chloroplast RF21 (chloroplast) [Schefflera delavayi] AGG39281.1 hypothetical chloroplast RF21 (chloroplast) [Schefflera delavayi] Length = 2132 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_008814900.1 hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] YP_008814919.1 hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] AGG38999.1 hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] AGG39020.1 hypothetical chloroplast RF21 (chloroplast) [Aralia undulata] Length = 2132 Score = 73.6 bits (179), Expect = 4e-11 Identities = 35/40 (87%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDETYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >YP_008814987.1 hypothetical chloroplast RF21 (chloroplast) [Brassaiopsis hainla] YP_008815006.1 hypothetical chloroplast RF21 (chloroplast) [Brassaiopsis hainla] AGG39086.1 hypothetical chloroplast RF21 (chloroplast) [Brassaiopsis hainla] AGG39107.1 hypothetical chloroplast RF21 (chloroplast) [Brassaiopsis hainla] Length = 2116 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/40 (85%), Positives = 36/40 (90%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGDET+NLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDETHNLYKSFHFPSRSDPFVRRAIYSIADISGT 939 >ANS71812.1 Ycf2 (chloroplast) [Eleutherococcus sessiliflorus] ANS71832.1 Ycf2 (chloroplast) [Eleutherococcus sessiliflorus] Length = 2126 Score = 70.9 bits (172), Expect = 3e-10 Identities = 34/40 (85%), Positives = 35/40 (87%) Frame = +1 Query: 1 DFPQSGGDETYNLYKSFHFPS*SDPFIRRAICLIADIS*T 120 DFPQSGGD TYNLYKSFHFPS SDPF+RRAI IADIS T Sbjct: 900 DFPQSGGDGTYNLYKSFHFPSRSDPFVRRAIYSIADISGT 939