BLASTX nr result
ID: Panax25_contig00037179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00037179 (383 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZN06614.1 hypothetical protein DCAR_007451 [Daucus carota subsp... 60 7e-08 XP_017232503.1 PREDICTED: uncharacterized protein LOC108206643 [... 60 7e-08 >KZN06614.1 hypothetical protein DCAR_007451 [Daucus carota subsp. sativus] Length = 635 Score = 59.7 bits (143), Expect = 7e-08 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -3 Query: 381 ERTSNTSSKPANSKPVSAQAADASNGKNKFSIAKWFGFGK 262 ERTSN ++ AN KPV+ +A D+S KNKFSI KWFGFGK Sbjct: 596 ERTSNATTNSANPKPVATKAVDSSGAKNKFSIGKWFGFGK 635 >XP_017232503.1 PREDICTED: uncharacterized protein LOC108206643 [Daucus carota subsp. sativus] Length = 639 Score = 59.7 bits (143), Expect = 7e-08 Identities = 26/40 (65%), Positives = 31/40 (77%) Frame = -3 Query: 381 ERTSNTSSKPANSKPVSAQAADASNGKNKFSIAKWFGFGK 262 ERTSN ++ AN KPV+ +A D+S KNKFSI KWFGFGK Sbjct: 600 ERTSNATTNSANPKPVATKAVDSSGAKNKFSIGKWFGFGK 639