BLASTX nr result
ID: Panax25_contig00036980
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00036980 (596 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAN08254.1 hypothetical protein [Oryza sativa Japonica Group] 55 5e-06 >AAN08254.1 hypothetical protein [Oryza sativa Japonica Group] Length = 162 Score = 54.7 bits (130), Expect = 5e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -2 Query: 595 RKHTPETLQRIRERTRLAMQDPKVMSCKNNFT 500 RKHTPETLQRIRERTR+AMQDPKV S K++ + Sbjct: 117 RKHTPETLQRIRERTRIAMQDPKVKSYKHSIS 148