BLASTX nr result
ID: Panax25_contig00036674
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00036674 (452 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017232975.1 PREDICTED: pentatricopeptide repeat-containing pr... 135 5e-37 XP_009630538.1 PREDICTED: pentatricopeptide repeat-containing pr... 123 2e-33 XP_012852998.1 PREDICTED: pentatricopeptide repeat-containing pr... 128 2e-33 XP_012852999.1 PREDICTED: pentatricopeptide repeat-containing pr... 128 2e-33 XP_019257370.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 3e-33 XP_009804752.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 4e-33 XP_017189209.1 PREDICTED: pentatricopeptide repeat-containing pr... 130 4e-33 OAY29049.1 hypothetical protein MANES_15G113900 [Manihot esculenta] 119 1e-32 XP_006486584.1 PREDICTED: pentatricopeptide repeat-containing pr... 123 2e-32 KDO68372.1 hypothetical protein CISIN_1g045672mg [Citrus sinensis] 123 2e-32 XP_006422411.1 hypothetical protein CICLE_v10028001mg [Citrus cl... 123 2e-32 XP_019151286.1 PREDICTED: pentatricopeptide repeat-containing pr... 119 2e-32 XP_015059941.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 2e-32 XP_006342434.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 2e-32 XP_004253182.1 PREDICTED: pentatricopeptide repeat-containing pr... 122 2e-32 XP_011040829.1 PREDICTED: pentatricopeptide repeat-containing pr... 123 2e-32 XP_010090714.1 hypothetical protein L484_013736 [Morus notabilis... 119 2e-32 XP_006384866.1 hypothetical protein POPTR_0004s21780g [Populus t... 123 2e-32 XP_011087234.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 3e-32 KZV34703.1 pentatricopeptide repeat-containing protein mitochond... 124 4e-32 >XP_017232975.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Daucus carota subsp. sativus] Length = 634 Score = 135 bits (341), Expect(2) = 5e-37 Identities = 61/73 (83%), Positives = 66/73 (90%) Frame = +2 Query: 74 TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIVIRDPIRYH 253 +LLYHSEKLAI+FGMMY +KGK IR RKNL ICGDCHVFTKLL+KIE C IVIRDPIRYH Sbjct: 562 SLLYHSEKLAIMFGMMYSVKGKAIRIRKNLRICGDCHVFTKLLSKIEDCYIVIRDPIRYH 621 Query: 254 HFRDGICSCGDYW 292 HFRDGICSC D+W Sbjct: 622 HFRDGICSCEDFW 634 Score = 46.2 bits (108), Expect(2) = 5e-37 Identities = 20/26 (76%), Positives = 24/26 (92%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 +LKQVGYVPDT+FV+ DLEG+Q EDS Sbjct: 537 RLKQVGYVPDTNFVLHDLEGEQMEDS 562 >XP_009630538.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] XP_009630539.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] XP_016494488.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016494497.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016494504.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016494510.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016494514.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_018621821.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] XP_018621822.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana tomentosiformis] Length = 659 Score = 123 bits (308), Expect(2) = 2e-33 Identities = 55/73 (75%), Positives = 64/73 (87%) Frame = +2 Query: 74 TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIVIRDPIRYH 253 +LLYHSEK+A+ FG+M L + KTIR RKNL ICGDCH+F KLLA+IE +IVIRDPIRYH Sbjct: 587 SLLYHSEKIAVAFGVMSLSREKTIRIRKNLRICGDCHLFAKLLAQIERRSIVIRDPIRYH 646 Query: 254 HFRDGICSCGDYW 292 HF+DGICSCGDYW Sbjct: 647 HFQDGICSCGDYW 659 Score = 47.0 bits (110), Expect(2) = 2e-33 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 +LK+VGYVPDT+FV+QDLEG+Q EDS Sbjct: 562 RLKEVGYVPDTNFVLQDLEGEQMEDS 587 >XP_012852998.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X1 [Erythranthe guttata] Length = 696 Score = 128 bits (322), Expect(2) = 2e-33 Identities = 58/73 (79%), Positives = 64/73 (87%) Frame = +2 Query: 74 TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIVIRDPIRYH 253 +L +HSEKLAIVFGMM L+KGKT+R RKNL ICGDCHVF KLLAK+E +IVIRDPIRYH Sbjct: 624 SLAHHSEKLAIVFGMMSLLKGKTVRIRKNLRICGDCHVFAKLLAKMESRSIVIRDPIRYH 683 Query: 254 HFRDGICSCGDYW 292 HF DG CSCGDYW Sbjct: 684 HFEDGSCSCGDYW 696 Score = 41.2 bits (95), Expect(2) = 2e-33 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 +LK GYVPDT+FV+QDLEG+Q E+S Sbjct: 599 RLKGEGYVPDTNFVLQDLEGEQMENS 624 >XP_012852999.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial isoform X2 [Erythranthe guttata] Length = 662 Score = 128 bits (322), Expect(2) = 2e-33 Identities = 58/73 (79%), Positives = 64/73 (87%) Frame = +2 Query: 74 TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIVIRDPIRYH 253 +L +HSEKLAIVFGMM L+KGKT+R RKNL ICGDCHVF KLLAK+E +IVIRDPIRYH Sbjct: 590 SLAHHSEKLAIVFGMMSLLKGKTVRIRKNLRICGDCHVFAKLLAKMESRSIVIRDPIRYH 649 Query: 254 HFRDGICSCGDYW 292 HF DG CSCGDYW Sbjct: 650 HFEDGSCSCGDYW 662 Score = 41.2 bits (95), Expect(2) = 2e-33 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 +LK GYVPDT+FV+QDLEG+Q E+S Sbjct: 565 RLKGEGYVPDTNFVLQDLEGEQMENS 590 >XP_019257370.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana attenuata] XP_019257371.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana attenuata] XP_019257372.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana attenuata] OIS96339.1 pentatricopeptide repeat-containing protein, mitochondrial [Nicotiana attenuata] Length = 659 Score = 122 bits (306), Expect(2) = 3e-33 Identities = 55/73 (75%), Positives = 64/73 (87%) Frame = +2 Query: 74 TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIVIRDPIRYH 253 +LLYHSEK+A+ FG+M L + KTIR RKNL ICGDCH+F KLLA+IE +IVIRDPIRYH Sbjct: 587 SLLYHSEKIAVSFGVMSLSREKTIRIRKNLRICGDCHLFAKLLAQIERRSIVIRDPIRYH 646 Query: 254 HFRDGICSCGDYW 292 HF+DGICSCGDYW Sbjct: 647 HFQDGICSCGDYW 659 Score = 47.0 bits (110), Expect(2) = 3e-33 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 +LK+VGYVPDT+FV+QDLEG+Q EDS Sbjct: 562 RLKEVGYVPDTNFVLQDLEGEQMEDS 587 >XP_009804752.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_009804753.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_009804754.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_009804755.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_009804757.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_009804758.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_009804759.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Nicotiana sylvestris] XP_016449016.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016449017.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016449018.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016449019.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] XP_016449020.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Nicotiana tabacum] Length = 659 Score = 122 bits (305), Expect(2) = 4e-33 Identities = 54/73 (73%), Positives = 64/73 (87%) Frame = +2 Query: 74 TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIVIRDPIRYH 253 +LLYHSEK+A+ FG++ L + KTIR RKNL ICGDCH+F KLLA+IE +IVIRDPIRYH Sbjct: 587 SLLYHSEKIAVAFGVLSLSREKTIRIRKNLRICGDCHLFAKLLAQIERRSIVIRDPIRYH 646 Query: 254 HFRDGICSCGDYW 292 HF+DGICSCGDYW Sbjct: 647 HFQDGICSCGDYW 659 Score = 47.0 bits (110), Expect(2) = 4e-33 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 +LK+VGYVPDT+FV+QDLEG+Q EDS Sbjct: 562 RLKEVGYVPDTNFVLQDLEGEQMEDS 587 >XP_017189209.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Malus domestica] Length = 435 Score = 130 bits (326), Expect = 4e-33 Identities = 61/81 (75%), Positives = 71/81 (87%), Gaps = 1/81 (1%) Frame = +2 Query: 53 LKGNRRK-TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIV 229 L+G +R+ +LL HSEKLAIVFG+M L KGKT+R RKNL ICGDCHVF KL+AKIE +IV Sbjct: 355 LEGEQREVSLLSHSEKLAIVFGLMSLSKGKTVRIRKNLRICGDCHVFAKLVAKIEERSIV 414 Query: 230 IRDPIRYHHFRDGICSCGDYW 292 IRDPIRYHHF+DG+CSCGDYW Sbjct: 415 IRDPIRYHHFQDGVCSCGDYW 435 >OAY29049.1 hypothetical protein MANES_15G113900 [Manihot esculenta] Length = 585 Score = 119 bits (298), Expect(2) = 1e-32 Identities = 56/81 (69%), Positives = 68/81 (83%), Gaps = 1/81 (1%) Frame = +2 Query: 53 LKGNRRK-TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIV 229 L+G +R+ +L +HSEKLA+VFG+M L K +TIR RKNL ICGDCH+F KL+AK+E IV Sbjct: 505 LEGEQREDSLRHHSEKLALVFGLMSLSKEQTIRIRKNLRICGDCHLFAKLVAKVEHRIIV 564 Query: 230 IRDPIRYHHFRDGICSCGDYW 292 IRDPIRYHHFR G+CSCGDYW Sbjct: 565 IRDPIRYHHFRYGVCSCGDYW 585 Score = 47.8 bits (112), Expect(2) = 1e-32 Identities = 21/26 (80%), Positives = 25/26 (96%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 KLK VGYVPDT+FV+QDLEG+Q+EDS Sbjct: 488 KLKGVGYVPDTNFVLQDLEGEQREDS 513 >XP_006486584.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Citrus sinensis] Length = 645 Score = 123 bits (308), Expect(2) = 2e-32 Identities = 57/81 (70%), Positives = 67/81 (82%), Gaps = 1/81 (1%) Frame = +2 Query: 53 LKGNRRK-TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIV 229 L+G +++ ++ YHSEKLAIVFG+M L +GKTIR RKNL ICGDCH F KL AK+E IV Sbjct: 565 LEGEQKEDSIQYHSEKLAIVFGLMSLTQGKTIRIRKNLRICGDCHTFAKLTAKMENQTIV 624 Query: 230 IRDPIRYHHFRDGICSCGDYW 292 IRDPIRYHHF+DG CSCGDYW Sbjct: 625 IRDPIRYHHFQDGNCSCGDYW 645 Score = 43.5 bits (101), Expect(2) = 2e-32 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 KL VGY PDT++V+QDLEG+QKEDS Sbjct: 548 KLVGVGYAPDTNYVLQDLEGEQKEDS 573 >KDO68372.1 hypothetical protein CISIN_1g045672mg [Citrus sinensis] Length = 643 Score = 123 bits (308), Expect(2) = 2e-32 Identities = 57/81 (70%), Positives = 67/81 (82%), Gaps = 1/81 (1%) Frame = +2 Query: 53 LKGNRRK-TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIV 229 L+G +++ ++ YHSEKLAIVFG+M L +GKTIR RKNL ICGDCH F KL AK+E IV Sbjct: 563 LEGEQKEDSIQYHSEKLAIVFGLMSLTQGKTIRIRKNLRICGDCHTFAKLTAKMENQTIV 622 Query: 230 IRDPIRYHHFRDGICSCGDYW 292 IRDPIRYHHF+DG CSCGDYW Sbjct: 623 IRDPIRYHHFQDGNCSCGDYW 643 Score = 43.5 bits (101), Expect(2) = 2e-32 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 KL VGY PDT++V+QDLEG+QKEDS Sbjct: 546 KLVGVGYAPDTNYVLQDLEGEQKEDS 571 >XP_006422411.1 hypothetical protein CICLE_v10028001mg [Citrus clementina] ESR35651.1 hypothetical protein CICLE_v10028001mg [Citrus clementina] Length = 643 Score = 123 bits (308), Expect(2) = 2e-32 Identities = 57/81 (70%), Positives = 67/81 (82%), Gaps = 1/81 (1%) Frame = +2 Query: 53 LKGNRRK-TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIV 229 L+G +++ ++ YHSEKLAIVFG+M L +GKTIR RKNL ICGDCH F KL AK+E IV Sbjct: 563 LEGEQKEDSIQYHSEKLAIVFGLMSLTQGKTIRIRKNLRICGDCHTFAKLTAKMENQTIV 622 Query: 230 IRDPIRYHHFRDGICSCGDYW 292 IRDPIRYHHF+DG CSCGDYW Sbjct: 623 IRDPIRYHHFQDGNCSCGDYW 643 Score = 43.5 bits (101), Expect(2) = 2e-32 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 KL VGY PDT++V+QDLEG+QKEDS Sbjct: 546 KLVGVGYAPDTNYVLQDLEGEQKEDS 571 >XP_019151286.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Ipomoea nil] Length = 672 Score = 119 bits (298), Expect(2) = 2e-32 Identities = 54/73 (73%), Positives = 61/73 (83%) Frame = +2 Query: 74 TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIVIRDPIRYH 253 +LLYHSEKLAI FG+M L + KTIR RKNL ICGDCH+F KLL K+E IVIRDPIRYH Sbjct: 600 SLLYHSEKLAIAFGIMSLPREKTIRIRKNLRICGDCHLFAKLLTKVEHRTIVIRDPIRYH 659 Query: 254 HFRDGICSCGDYW 292 HF++GICSC DYW Sbjct: 660 HFQEGICSCSDYW 672 Score = 47.0 bits (110), Expect(2) = 2e-32 Identities = 20/26 (76%), Positives = 25/26 (96%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 +LK+VGYVPDT+FV+QDLEG+Q EDS Sbjct: 575 RLKEVGYVPDTNFVLQDLEGEQMEDS 600 >XP_015059941.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Solanum pennellii] Length = 654 Score = 122 bits (305), Expect(2) = 2e-32 Identities = 54/73 (73%), Positives = 64/73 (87%) Frame = +2 Query: 74 TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIVIRDPIRYH 253 +LLYHSEK+A+ FG++ L + KTIR RKNL ICGDCH+F KLLA+IE +IVIRDPIRYH Sbjct: 582 SLLYHSEKIAVAFGILSLSREKTIRIRKNLRICGDCHLFVKLLAQIEHRSIVIRDPIRYH 641 Query: 254 HFRDGICSCGDYW 292 HF+DGICSCGDYW Sbjct: 642 HFQDGICSCGDYW 654 Score = 44.3 bits (103), Expect(2) = 2e-32 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 +LK+VGYVPDT+FV+QDLE +Q EDS Sbjct: 557 RLKEVGYVPDTNFVLQDLEDEQMEDS 582 >XP_006342434.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Solanum tuberosum] XP_015162048.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Solanum tuberosum] Length = 654 Score = 122 bits (305), Expect(2) = 2e-32 Identities = 54/73 (73%), Positives = 64/73 (87%) Frame = +2 Query: 74 TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIVIRDPIRYH 253 +LLYHSEK+A+ FG++ L + KTIR RKNL ICGDCH+F KLLA+IE +IVIRDPIRYH Sbjct: 582 SLLYHSEKIAVAFGVLSLSREKTIRIRKNLRICGDCHLFVKLLAQIERRSIVIRDPIRYH 641 Query: 254 HFRDGICSCGDYW 292 HF+DGICSCGDYW Sbjct: 642 HFQDGICSCGDYW 654 Score = 44.3 bits (103), Expect(2) = 2e-32 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 +LK+VGYVPDT+FV+QDLE +Q EDS Sbjct: 557 RLKEVGYVPDTNFVLQDLEDEQMEDS 582 >XP_004253182.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Solanum lycopersicum] Length = 654 Score = 122 bits (305), Expect(2) = 2e-32 Identities = 54/73 (73%), Positives = 64/73 (87%) Frame = +2 Query: 74 TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIVIRDPIRYH 253 +LLYHSEK+A+ FG++ L + KTIR RKNL ICGDCH+F KLLA+IE +IVIRDPIRYH Sbjct: 582 SLLYHSEKIAVAFGILSLSREKTIRIRKNLRICGDCHLFVKLLAQIEHRSIVIRDPIRYH 641 Query: 254 HFRDGICSCGDYW 292 HF+DGICSCGDYW Sbjct: 642 HFQDGICSCGDYW 654 Score = 44.3 bits (103), Expect(2) = 2e-32 Identities = 19/26 (73%), Positives = 24/26 (92%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 +LK+VGYVPDT+FV+QDLE +Q EDS Sbjct: 557 RLKEVGYVPDTNFVLQDLEDEQMEDS 582 >XP_011040829.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Populus euphratica] Length = 644 Score = 123 bits (308), Expect(2) = 2e-32 Identities = 55/73 (75%), Positives = 65/73 (89%) Frame = +2 Query: 74 TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIVIRDPIRYH 253 +L YHSEKLAIVFG+M L +G+TIR RKNL ICGDCH+FTKLLAK+E IVIRDP+RYH Sbjct: 572 SLRYHSEKLAIVFGLMSLPRGQTIRIRKNLRICGDCHLFTKLLAKMEQRIIVIRDPVRYH 631 Query: 254 HFRDGICSCGDYW 292 HF+DG+CSCGD+W Sbjct: 632 HFQDGLCSCGDFW 644 Score = 43.1 bits (100), Expect(2) = 2e-32 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 KL VGYVPDT+FV+QDLEG+Q +DS Sbjct: 547 KLMGVGYVPDTNFVLQDLEGEQMQDS 572 >XP_010090714.1 hypothetical protein L484_013736 [Morus notabilis] EXB40433.1 hypothetical protein L484_013736 [Morus notabilis] Length = 640 Score = 119 bits (299), Expect(2) = 2e-32 Identities = 56/81 (69%), Positives = 67/81 (82%), Gaps = 1/81 (1%) Frame = +2 Query: 53 LKGNRRK-TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIV 229 L+G +R+ +L YHSEKLAIVFGMM L K K IR RKN+ ICGDCHVF KL+AK+E +V Sbjct: 560 LEGEQREDSLRYHSEKLAIVFGMMRLPKEKIIRVRKNIRICGDCHVFAKLIAKMEERIVV 619 Query: 230 IRDPIRYHHFRDGICSCGDYW 292 IRDP+RYHHF++G CSCGDYW Sbjct: 620 IRDPVRYHHFQNGACSCGDYW 640 Score = 46.6 bits (109), Expect(2) = 2e-32 Identities = 19/26 (73%), Positives = 25/26 (96%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 +LK+ GYVPDT+FV+QDLEG+Q+EDS Sbjct: 543 RLKEAGYVPDTNFVLQDLEGEQREDS 568 >XP_006384866.1 hypothetical protein POPTR_0004s21780g [Populus trichocarpa] ERP62663.1 hypothetical protein POPTR_0004s21780g [Populus trichocarpa] Length = 571 Score = 123 bits (308), Expect(2) = 2e-32 Identities = 55/73 (75%), Positives = 65/73 (89%) Frame = +2 Query: 74 TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIVIRDPIRYH 253 +L YHSEKLAIVFG+M L +G+TIR RKNL ICGDCH+FTKLLAK+E IVIRDP+RYH Sbjct: 499 SLRYHSEKLAIVFGLMSLPRGQTIRIRKNLRICGDCHLFTKLLAKMEQRIIVIRDPVRYH 558 Query: 254 HFRDGICSCGDYW 292 HF+DG+CSCGD+W Sbjct: 559 HFQDGLCSCGDFW 571 Score = 43.1 bits (100), Expect(2) = 2e-32 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 KL VGYVPDT+FV+QDLEG+Q +DS Sbjct: 474 KLMGVGYVPDTNFVLQDLEGEQMQDS 499 >XP_011087234.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Sesamum indicum] XP_011087235.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Sesamum indicum] XP_011087237.1 PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial [Sesamum indicum] Length = 661 Score = 124 bits (311), Expect(2) = 3e-32 Identities = 57/73 (78%), Positives = 63/73 (86%) Frame = +2 Query: 74 TLLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIVIRDPIRYH 253 +L YHSEKLAIVFGMM L +GKT+R RKNL ICGDCH F KLLAK+E +IVIRDPIRYH Sbjct: 589 SLAYHSEKLAIVFGMMCLPEGKTVRIRKNLRICGDCHDFAKLLAKMENRSIVIRDPIRYH 648 Query: 254 HFRDGICSCGDYW 292 HF+ GICSCGDYW Sbjct: 649 HFQGGICSCGDYW 661 Score = 41.6 bits (96), Expect(2) = 3e-32 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 +LK GYVPDT+FV+QDLEG+Q E+S Sbjct: 564 RLKAEGYVPDTNFVLQDLEGEQMENS 589 >KZV34703.1 pentatricopeptide repeat-containing protein mitochondrial [Dorcoceras hygrometricum] Length = 585 Score = 124 bits (312), Expect(2) = 4e-32 Identities = 58/81 (71%), Positives = 67/81 (82%), Gaps = 1/81 (1%) Frame = +2 Query: 53 LKGNRRKT-LLYHSEKLAIVFGMMYLIKGKTIRSRKNLWICGDCHVFTKLLAKIEGCNIV 229 ++G + +T LLYHSEKLAI FG+M KGKTIR RKNL ICGDCHVF KL+ K+E +IV Sbjct: 505 VEGEQMETSLLYHSEKLAITFGIMSFPKGKTIRIRKNLRICGDCHVFAKLVTKMENQSIV 564 Query: 230 IRDPIRYHHFRDGICSCGDYW 292 IRDPIRYHHF+DG CSCGDYW Sbjct: 565 IRDPIRYHHFQDGACSCGDYW 585 Score = 40.8 bits (94), Expect(2) = 4e-32 Identities = 17/26 (65%), Positives = 23/26 (88%) Frame = +1 Query: 1 KLKQVGYVPDTDFVVQDLEGKQKEDS 78 +LK+ GYVPDT+FV+QD+EG+Q E S Sbjct: 488 RLKEEGYVPDTNFVLQDVEGEQMETS 513