BLASTX nr result
ID: Panax25_contig00036541
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00036541 (796 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OMP04254.1 hypothetical protein COLO4_09815 [Corchorus olitorius] 59 4e-08 XP_016902962.1 PREDICTED: meiotic recombination protein SPO11-1 ... 59 1e-06 XP_016902961.1 PREDICTED: meiotic recombination protein SPO11-1 ... 59 1e-06 XP_017251404.1 PREDICTED: meiotic recombination protein SPO11-1-... 59 3e-06 XP_010324272.1 PREDICTED: meiotic recombination protein SPO11-1 ... 59 3e-06 XP_010644562.1 PREDICTED: meiotic recombination protein SPO11-1 ... 58 5e-06 KDO59088.1 hypothetical protein CISIN_1g043133mg, partial [Citru... 54 8e-06 >OMP04254.1 hypothetical protein COLO4_09815 [Corchorus olitorius] Length = 82 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 601 EQSVVDRAINDICILLQCSRHNLNVVCTIPI 509 +QSVVDRAINDICILLQCSRHNLNV TIP+ Sbjct: 16 DQSVVDRAINDICILLQCSRHNLNVAHTIPV 46 >XP_016902962.1 PREDICTED: meiotic recombination protein SPO11-1 isoform X4 [Cucumis melo] Length = 349 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 616 HVAKTEQSVVDRAINDICILLQCSRHNLNVV 524 HV + +QSVVDRAINDICILLQCSRHNLNVV Sbjct: 69 HVRRLDQSVVDRAINDICILLQCSRHNLNVV 99 >XP_016902961.1 PREDICTED: meiotic recombination protein SPO11-1 isoform X3 [Cucumis melo] Length = 352 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -1 Query: 616 HVAKTEQSVVDRAINDICILLQCSRHNLNVV 524 HV + +QSVVDRAINDICILLQCSRHNLNVV Sbjct: 72 HVRRLDQSVVDRAINDICILLQCSRHNLNVV 102 >XP_017251404.1 PREDICTED: meiotic recombination protein SPO11-1-like, partial [Daucus carota subsp. sativus] Length = 346 Score = 58.5 bits (140), Expect = 3e-06 Identities = 30/47 (63%), Positives = 36/47 (76%), Gaps = 3/47 (6%) Frame = -1 Query: 604 TEQSVVDRAINDICILLQCSRHNLNVVCT---IPISYLFFESAFQLY 473 TEQSVVDRAINDICILLQCSRHNLNVV + + +L F A +++ Sbjct: 30 TEQSVVDRAINDICILLQCSRHNLNVVSVGKGLVMGWLRFSEAGRIF 76 >XP_010324272.1 PREDICTED: meiotic recombination protein SPO11-1 isoform X3 [Solanum lycopersicum] Length = 355 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = -1 Query: 601 EQSVVDRAINDICILLQCSRHNLNVVCTIPISYLFFE 491 EQSVVDRAINDICILLQCSRHNLNV + ++ L E Sbjct: 111 EQSVVDRAINDICILLQCSRHNLNVAMAVTVTPLMLE 147 >XP_010644562.1 PREDICTED: meiotic recombination protein SPO11-1 isoform X7 [Vitis vinifera] Length = 354 Score = 57.8 bits (138), Expect = 5e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 616 HVAKTEQSVVDRAINDICILLQCSRHNLNVV 524 H + +QSVVDRAINDICILLQCSRHNLNVV Sbjct: 72 HARRLDQSVVDRAINDICILLQCSRHNLNVV 102 >KDO59088.1 hypothetical protein CISIN_1g043133mg, partial [Citrus sinensis] Length = 131 Score = 54.3 bits (129), Expect = 8e-06 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = -1 Query: 604 TEQSVVDRAINDICILLQCSRHNLNVVCT 518 +EQS+VD+AINDICILLQCSRHN+NVV T Sbjct: 91 SEQSIVDQAINDICILLQCSRHNINVVGT 119