BLASTX nr result
ID: Panax25_contig00036478
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00036478 (636 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY33869.1 hypothetical protein MANES_13G131800 [Manihot esculenta] 59 3e-08 KZN02189.1 hypothetical protein DCAR_010943 [Daucus carota subsp... 53 1e-05 >OAY33869.1 hypothetical protein MANES_13G131800 [Manihot esculenta] Length = 99 Score = 59.3 bits (142), Expect = 3e-08 Identities = 27/52 (51%), Positives = 36/52 (69%), Gaps = 3/52 (5%) Frame = -1 Query: 465 DKDVVLRRIRHHKHLKKVQTTFQALL---QHQQRSYSSEHRWLEHDDAF*FP 319 D++V+LRRIRHHK LKKVQ FQAL+ +H+ + RWL+H+D F P Sbjct: 48 DREVILRRIRHHKTLKKVQNAFQALISSSEHENMVSKNRQRWLDHEDCFSSP 99 >KZN02189.1 hypothetical protein DCAR_010943 [Daucus carota subsp. sativus] Length = 104 Score = 52.8 bits (125), Expect = 1e-05 Identities = 29/49 (59%), Positives = 31/49 (63%) Frame = -1 Query: 465 DKDVVLRRIRHHKHLKKVQTTFQALLQHQQRSYSSEHRWLEHDDAF*FP 319 D+ VVLRRIR HK LKKVQ TFQALL +S WLE DD F P Sbjct: 60 DRQVVLRRIRQHKCLKKVQNTFQALLPQA----ASHQGWLEQDDVFTSP 104