BLASTX nr result
ID: Panax25_contig00036432
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Panax25_contig00036432 (501 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP00965.1 unnamed protein product [Coffea canephora] 55 1e-05 >CDP00965.1 unnamed protein product [Coffea canephora] Length = 386 Score = 54.7 bits (130), Expect = 1e-05 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +2 Query: 407 MASIRRTLSPYHDRSYQNGGSPFSVQLPSPK 499 MASIRRTLSPYHDR YQNGG+PFSV+ S K Sbjct: 1 MASIRRTLSPYHDRPYQNGGNPFSVESASHK 31